Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1GDY0

Protein Details
Accession A0A6G1GDY0    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
15-42LLWKIPYRLSRPQKYRHRQRLKHVDKVVHydrophilic
76-105DKYTMFDKKVKKYRKGIHKLPKWTRVSQRLHydrophilic
NLS Segment(s)
PositionSequence
84-97KVKKYRKGIHKLPK
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGAFRPSGPLFGGLLWKIPYRLSRPQKYRHRQRLKHVDKVVATVDAALQKLGKPVAAVERWKEEMPTEAEMLAKDKYTMFDKKVKKYRKGIHKLPKWTRVSQRLNPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.17
4 0.17
5 0.16
6 0.18
7 0.22
8 0.24
9 0.35
10 0.42
11 0.51
12 0.57
13 0.67
14 0.75
15 0.82
16 0.87
17 0.88
18 0.89
19 0.86
20 0.89
21 0.91
22 0.87
23 0.85
24 0.78
25 0.72
26 0.61
27 0.56
28 0.46
29 0.35
30 0.27
31 0.17
32 0.15
33 0.1
34 0.1
35 0.07
36 0.07
37 0.06
38 0.08
39 0.08
40 0.07
41 0.05
42 0.06
43 0.1
44 0.12
45 0.13
46 0.14
47 0.17
48 0.19
49 0.19
50 0.19
51 0.15
52 0.16
53 0.17
54 0.17
55 0.15
56 0.13
57 0.13
58 0.13
59 0.14
60 0.12
61 0.09
62 0.08
63 0.08
64 0.1
65 0.15
66 0.19
67 0.21
68 0.29
69 0.36
70 0.46
71 0.55
72 0.63
73 0.67
74 0.73
75 0.79
76 0.81
77 0.84
78 0.85
79 0.86
80 0.85
81 0.88
82 0.87
83 0.87
84 0.82
85 0.81
86 0.8
87 0.8
88 0.8
89 0.77
90 0.79