Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P5C0

Protein Details
Accession F4P5C0   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-36IETVKARKLELQKKARRPEGLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 6, mito 4
Family & Domain DBs
Amino Acid Sequences MSQYDKNELKAVGLKIETVKARKLELQKKARRPEGLTTDEQVELEDFDWKETLQELKKDEKYWKELIKLATKEEPKEESKSFREADDKWISSITSINTTYREWTTFDLDDSINPSEHFYSRLKQSVSLVHMRYEAGRRFILNDFLLDVLYRPEFKESLRIFPEIQMEVSKTVGNKKRKITGNTDYTIGLGKGYDIFSKAPPKELHLIAIEAKTSWDEDDYWQCVAETATLYKSRKDAGKTKCSVWGVLSNAADWQFIFIDEQGLLWTSRKILINLRSLDEEQVVKVYRFLYFLVKSCFGACTPNLTPSSSYDIIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.31
4 0.33
5 0.3
6 0.34
7 0.31
8 0.34
9 0.39
10 0.48
11 0.52
12 0.56
13 0.64
14 0.69
15 0.77
16 0.83
17 0.83
18 0.79
19 0.75
20 0.74
21 0.72
22 0.68
23 0.61
24 0.54
25 0.5
26 0.44
27 0.39
28 0.29
29 0.21
30 0.16
31 0.13
32 0.15
33 0.13
34 0.13
35 0.14
36 0.13
37 0.13
38 0.14
39 0.2
40 0.19
41 0.24
42 0.27
43 0.35
44 0.39
45 0.43
46 0.48
47 0.48
48 0.5
49 0.53
50 0.54
51 0.5
52 0.5
53 0.52
54 0.54
55 0.49
56 0.46
57 0.47
58 0.45
59 0.43
60 0.42
61 0.41
62 0.36
63 0.4
64 0.39
65 0.38
66 0.37
67 0.41
68 0.38
69 0.35
70 0.37
71 0.32
72 0.38
73 0.39
74 0.36
75 0.31
76 0.31
77 0.29
78 0.24
79 0.25
80 0.18
81 0.14
82 0.15
83 0.15
84 0.16
85 0.17
86 0.19
87 0.18
88 0.18
89 0.16
90 0.17
91 0.2
92 0.19
93 0.18
94 0.18
95 0.16
96 0.15
97 0.17
98 0.16
99 0.12
100 0.12
101 0.13
102 0.12
103 0.12
104 0.15
105 0.14
106 0.16
107 0.2
108 0.24
109 0.24
110 0.23
111 0.25
112 0.27
113 0.29
114 0.31
115 0.28
116 0.24
117 0.24
118 0.23
119 0.23
120 0.24
121 0.22
122 0.19
123 0.18
124 0.18
125 0.2
126 0.2
127 0.22
128 0.16
129 0.15
130 0.12
131 0.12
132 0.11
133 0.09
134 0.08
135 0.06
136 0.06
137 0.06
138 0.06
139 0.07
140 0.08
141 0.08
142 0.17
143 0.17
144 0.22
145 0.23
146 0.25
147 0.23
148 0.25
149 0.27
150 0.18
151 0.18
152 0.13
153 0.12
154 0.11
155 0.11
156 0.1
157 0.08
158 0.16
159 0.24
160 0.3
161 0.35
162 0.39
163 0.46
164 0.52
165 0.56
166 0.56
167 0.56
168 0.55
169 0.51
170 0.48
171 0.4
172 0.34
173 0.3
174 0.22
175 0.14
176 0.07
177 0.06
178 0.06
179 0.07
180 0.07
181 0.08
182 0.09
183 0.12
184 0.19
185 0.19
186 0.24
187 0.24
188 0.27
189 0.31
190 0.3
191 0.29
192 0.23
193 0.24
194 0.2
195 0.2
196 0.16
197 0.12
198 0.11
199 0.09
200 0.09
201 0.08
202 0.07
203 0.07
204 0.1
205 0.15
206 0.16
207 0.16
208 0.16
209 0.15
210 0.15
211 0.14
212 0.12
213 0.09
214 0.09
215 0.11
216 0.17
217 0.18
218 0.19
219 0.21
220 0.23
221 0.27
222 0.32
223 0.38
224 0.41
225 0.51
226 0.52
227 0.53
228 0.56
229 0.53
230 0.47
231 0.41
232 0.38
233 0.31
234 0.32
235 0.3
236 0.23
237 0.24
238 0.23
239 0.2
240 0.14
241 0.13
242 0.08
243 0.08
244 0.09
245 0.08
246 0.09
247 0.08
248 0.09
249 0.07
250 0.08
251 0.09
252 0.09
253 0.09
254 0.09
255 0.14
256 0.16
257 0.18
258 0.25
259 0.31
260 0.38
261 0.4
262 0.41
263 0.41
264 0.4
265 0.39
266 0.34
267 0.28
268 0.21
269 0.23
270 0.22
271 0.18
272 0.19
273 0.18
274 0.17
275 0.17
276 0.18
277 0.21
278 0.22
279 0.26
280 0.31
281 0.32
282 0.31
283 0.31
284 0.32
285 0.25
286 0.27
287 0.23
288 0.24
289 0.24
290 0.3
291 0.31
292 0.31
293 0.32
294 0.31
295 0.38