Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6G1GCN6

Protein Details
Accession A0A6G1GCN6    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
73-104LSAKSKEARKLAKKQRKDTQKKEKAAKARDAAHydrophilic
NLS Segment(s)
PositionSequence
76-103KSKEARKLAKKQRKDTQKKEKAAKARDA
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MSKLPRQDRLPLCPPTHLVGPSTPLSLPAARAKIEAYLALCATTPHLHPDAKPKHDHATAGAPMNGVDGHGELSAKSKEARKLAKKQRKDTQKKEKAAKARDAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.46
3 0.44
4 0.37
5 0.31
6 0.24
7 0.26
8 0.24
9 0.23
10 0.19
11 0.16
12 0.17
13 0.16
14 0.17
15 0.18
16 0.19
17 0.18
18 0.18
19 0.18
20 0.16
21 0.16
22 0.15
23 0.11
24 0.1
25 0.09
26 0.09
27 0.08
28 0.07
29 0.09
30 0.09
31 0.08
32 0.1
33 0.12
34 0.13
35 0.13
36 0.24
37 0.29
38 0.31
39 0.33
40 0.33
41 0.36
42 0.36
43 0.36
44 0.28
45 0.27
46 0.25
47 0.24
48 0.22
49 0.17
50 0.15
51 0.15
52 0.13
53 0.08
54 0.06
55 0.04
56 0.05
57 0.05
58 0.05
59 0.05
60 0.09
61 0.09
62 0.1
63 0.12
64 0.17
65 0.22
66 0.29
67 0.39
68 0.45
69 0.55
70 0.66
71 0.74
72 0.79
73 0.83
74 0.86
75 0.88
76 0.9
77 0.9
78 0.9
79 0.9
80 0.9
81 0.9
82 0.89
83 0.87
84 0.84