Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4P1U7

Protein Details
Accession F4P1U7    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
146-170VDQYQQKREEKKGRVEKNQMQQRRNHydrophilic
NLS Segment(s)
PositionSequence
77-106PRAKPIPKENNKTRWEKFAAVKGIQKKKKS
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences VSVEKPVPVEFDLRCLAAFDPNPLDETELRSNKVDNYLKQWSRDGAQLLINAIFGLETNSNDDGYFAILPNLISRIPRAKPIPKENNKTRWEKFAAVKGIQKKKKSRMEYDESTQTYNPRYGYKGGEKDNLKDWIIEVPDNADPMVDQYQQKREEKKGRVEKNQMQQRRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.19
3 0.18
4 0.2
5 0.2
6 0.19
7 0.21
8 0.21
9 0.22
10 0.21
11 0.23
12 0.18
13 0.23
14 0.29
15 0.28
16 0.3
17 0.3
18 0.31
19 0.3
20 0.38
21 0.37
22 0.3
23 0.35
24 0.43
25 0.45
26 0.46
27 0.46
28 0.39
29 0.35
30 0.37
31 0.31
32 0.23
33 0.22
34 0.2
35 0.19
36 0.17
37 0.15
38 0.11
39 0.09
40 0.07
41 0.05
42 0.06
43 0.06
44 0.06
45 0.09
46 0.1
47 0.1
48 0.1
49 0.1
50 0.08
51 0.09
52 0.09
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.07
59 0.06
60 0.06
61 0.08
62 0.12
63 0.13
64 0.18
65 0.22
66 0.28
67 0.34
68 0.44
69 0.54
70 0.57
71 0.66
72 0.68
73 0.73
74 0.72
75 0.72
76 0.64
77 0.59
78 0.54
79 0.49
80 0.45
81 0.42
82 0.41
83 0.36
84 0.39
85 0.42
86 0.48
87 0.49
88 0.54
89 0.55
90 0.6
91 0.67
92 0.7
93 0.69
94 0.68
95 0.71
96 0.69
97 0.66
98 0.64
99 0.56
100 0.51
101 0.43
102 0.36
103 0.3
104 0.28
105 0.24
106 0.18
107 0.2
108 0.2
109 0.25
110 0.31
111 0.35
112 0.37
113 0.43
114 0.43
115 0.43
116 0.46
117 0.45
118 0.37
119 0.31
120 0.27
121 0.25
122 0.25
123 0.22
124 0.17
125 0.16
126 0.16
127 0.17
128 0.16
129 0.11
130 0.09
131 0.12
132 0.15
133 0.15
134 0.18
135 0.22
136 0.3
137 0.37
138 0.43
139 0.47
140 0.54
141 0.6
142 0.65
143 0.71
144 0.74
145 0.77
146 0.81
147 0.85
148 0.84
149 0.85
150 0.88