Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1G5Y7

Protein Details
Accession A0A6G1G5Y7    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
22-43PGTPKEKEKKFEKPKVTRNAPPBasic
NLS Segment(s)
PositionSequence
30-31KK
Subcellular Location(s) cyto 16.5, cyto_nucl 12.833, nucl 8, mito_nucl 4.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR039732  Hub1/Ubl5  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0036211  P:protein modification process  
Amino Acid Sequences MDSPNAASVDAKFGVPGTPGTPGTPKEKEKKFEKPKVTRNAPPVTFILVTVNDRLGTKAQVPCLASDTVRDFKLLVAAKIGRQPHEIMIKRQGQRPFKDNLTLDDYEVSNGVQLDLELSTGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.13
4 0.1
5 0.12
6 0.13
7 0.15
8 0.18
9 0.19
10 0.25
11 0.31
12 0.36
13 0.42
14 0.48
15 0.54
16 0.58
17 0.67
18 0.71
19 0.74
20 0.78
21 0.78
22 0.81
23 0.84
24 0.84
25 0.79
26 0.76
27 0.74
28 0.64
29 0.57
30 0.48
31 0.41
32 0.33
33 0.27
34 0.21
35 0.14
36 0.15
37 0.12
38 0.12
39 0.09
40 0.09
41 0.1
42 0.09
43 0.09
44 0.12
45 0.13
46 0.14
47 0.16
48 0.16
49 0.15
50 0.17
51 0.17
52 0.13
53 0.13
54 0.16
55 0.16
56 0.15
57 0.15
58 0.13
59 0.12
60 0.18
61 0.17
62 0.14
63 0.14
64 0.15
65 0.16
66 0.2
67 0.22
68 0.18
69 0.19
70 0.2
71 0.21
72 0.3
73 0.32
74 0.31
75 0.38
76 0.44
77 0.45
78 0.5
79 0.54
80 0.53
81 0.55
82 0.56
83 0.54
84 0.49
85 0.53
86 0.48
87 0.45
88 0.43
89 0.39
90 0.35
91 0.32
92 0.29
93 0.22
94 0.21
95 0.16
96 0.11
97 0.1
98 0.1
99 0.07
100 0.07
101 0.07
102 0.07