Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1G1T5

Protein Details
Accession A0A6G1G1T5    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
10-35DKLKGAFKGLFRKKSKKPVAEAAKPTHydrophilic
NLS Segment(s)
PositionSequence
17-27KGLFRKKSKKP
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
Amino Acid Sequences MPGVPLDAVDKLKGAFKGLFRKKSKKPVAEAAKPTEPTPTAPAAAADAKPTATTPAAPAPATAPAPAAAAAAAPATAPAADAAKPAADAPKPAEPSAEPAKPEPAAAPAAAATEPAKAPAAAPAKTAATPAAAEKPAPAPAAAPAVDAPATTAAAKPVKDAAPAAPLTTAAAAPAKDATPAAPAKDATPAAPAKDATPAAPAKDATPAAPAKDATPAAPAKDAAPAATPATEPAKEGMSATSGPLEDNPTLTTAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.25
4 0.36
5 0.45
6 0.54
7 0.58
8 0.67
9 0.73
10 0.8
11 0.84
12 0.82
13 0.79
14 0.8
15 0.82
16 0.82
17 0.79
18 0.75
19 0.72
20 0.64
21 0.57
22 0.52
23 0.42
24 0.36
25 0.33
26 0.28
27 0.22
28 0.21
29 0.21
30 0.19
31 0.21
32 0.18
33 0.15
34 0.14
35 0.13
36 0.13
37 0.13
38 0.13
39 0.1
40 0.11
41 0.12
42 0.15
43 0.17
44 0.17
45 0.17
46 0.16
47 0.18
48 0.18
49 0.16
50 0.12
51 0.1
52 0.11
53 0.1
54 0.09
55 0.06
56 0.05
57 0.05
58 0.04
59 0.04
60 0.03
61 0.03
62 0.03
63 0.03
64 0.03
65 0.04
66 0.05
67 0.05
68 0.05
69 0.06
70 0.06
71 0.06
72 0.06
73 0.09
74 0.08
75 0.09
76 0.12
77 0.18
78 0.2
79 0.19
80 0.2
81 0.17
82 0.22
83 0.27
84 0.26
85 0.21
86 0.21
87 0.23
88 0.22
89 0.22
90 0.17
91 0.13
92 0.12
93 0.11
94 0.1
95 0.07
96 0.08
97 0.07
98 0.07
99 0.06
100 0.06
101 0.06
102 0.06
103 0.07
104 0.06
105 0.06
106 0.12
107 0.14
108 0.14
109 0.14
110 0.15
111 0.15
112 0.15
113 0.15
114 0.09
115 0.07
116 0.07
117 0.07
118 0.09
119 0.09
120 0.08
121 0.09
122 0.1
123 0.11
124 0.11
125 0.1
126 0.07
127 0.08
128 0.1
129 0.09
130 0.09
131 0.07
132 0.07
133 0.07
134 0.07
135 0.06
136 0.05
137 0.05
138 0.05
139 0.05
140 0.08
141 0.1
142 0.1
143 0.1
144 0.13
145 0.13
146 0.14
147 0.14
148 0.13
149 0.15
150 0.15
151 0.14
152 0.11
153 0.11
154 0.1
155 0.1
156 0.09
157 0.05
158 0.07
159 0.06
160 0.07
161 0.08
162 0.07
163 0.07
164 0.08
165 0.07
166 0.11
167 0.12
168 0.12
169 0.13
170 0.14
171 0.14
172 0.18
173 0.18
174 0.13
175 0.17
176 0.17
177 0.16
178 0.18
179 0.18
180 0.14
181 0.18
182 0.18
183 0.13
184 0.17
185 0.17
186 0.16
187 0.18
188 0.18
189 0.14
190 0.18
191 0.18
192 0.13
193 0.17
194 0.17
195 0.16
196 0.18
197 0.18
198 0.14
199 0.18
200 0.18
201 0.13
202 0.17
203 0.17
204 0.16
205 0.18
206 0.18
207 0.14
208 0.18
209 0.18
210 0.14
211 0.15
212 0.16
213 0.15
214 0.15
215 0.15
216 0.13
217 0.17
218 0.17
219 0.16
220 0.16
221 0.17
222 0.16
223 0.17
224 0.15
225 0.14
226 0.14
227 0.14
228 0.15
229 0.13
230 0.14
231 0.14
232 0.18
233 0.15
234 0.16
235 0.16