Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4PAW8

Protein Details
Accession F4PAW8   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-22AKGLRSKSARRAKAVRREKVFHydrophilic
127-155FMNGNQFKKWKKSQSKIRRSKKNGHVGKKHydrophilic
NLS Segment(s)
PositionSequence
6-19RSKSARRAKAVRRE
134-155KKWKKSQSKIRRSKKNGHVGKK
Subcellular Location(s) nucl 19, mito_nucl 13.333, cyto_nucl 10.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKGLRSKSARRAKAVRREKVFGPVEEQRVLRLAAKLATGSEAATEMQVESISDSAEPTIKLDDRRGRSQSRNARSLSNSPMRMRSASAKSNKNEMDEDKVEDELDTPIDTSEALESMGKNERTRLFMNGNQFKKWKKSQSKIRRSKKNGHVGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.82
3 0.81
4 0.77
5 0.75
6 0.69
7 0.69
8 0.63
9 0.53
10 0.5
11 0.46
12 0.44
13 0.43
14 0.41
15 0.32
16 0.29
17 0.29
18 0.24
19 0.19
20 0.17
21 0.14
22 0.15
23 0.14
24 0.12
25 0.13
26 0.11
27 0.09
28 0.08
29 0.07
30 0.07
31 0.07
32 0.06
33 0.05
34 0.05
35 0.05
36 0.05
37 0.04
38 0.04
39 0.05
40 0.04
41 0.05
42 0.05
43 0.06
44 0.06
45 0.06
46 0.08
47 0.1
48 0.11
49 0.18
50 0.24
51 0.28
52 0.34
53 0.38
54 0.42
55 0.44
56 0.53
57 0.56
58 0.55
59 0.55
60 0.51
61 0.49
62 0.46
63 0.45
64 0.42
65 0.38
66 0.35
67 0.31
68 0.32
69 0.31
70 0.29
71 0.27
72 0.27
73 0.25
74 0.29
75 0.35
76 0.39
77 0.39
78 0.45
79 0.45
80 0.41
81 0.39
82 0.34
83 0.34
84 0.28
85 0.29
86 0.23
87 0.22
88 0.2
89 0.17
90 0.16
91 0.1
92 0.09
93 0.07
94 0.06
95 0.06
96 0.06
97 0.06
98 0.05
99 0.05
100 0.05
101 0.05
102 0.06
103 0.06
104 0.09
105 0.16
106 0.18
107 0.18
108 0.23
109 0.24
110 0.28
111 0.3
112 0.33
113 0.32
114 0.34
115 0.44
116 0.48
117 0.49
118 0.49
119 0.52
120 0.52
121 0.55
122 0.6
123 0.61
124 0.63
125 0.7
126 0.77
127 0.83
128 0.89
129 0.92
130 0.93
131 0.94
132 0.91
133 0.92
134 0.91
135 0.9