Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1FTX2

Protein Details
Accession A0A6G1FTX2    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
187-232DPIIRAKKKERVQLKKDRKRERKKWAKWWKKEQRSRAHGNDKRAEPBasic
NLS Segment(s)
PositionSequence
191-229RAKKKERVQLKKDRKRERKKWAKWWKKEQRSRAHGNDKR
Subcellular Location(s) nucl 16, mito_nucl 12.166, cyto_nucl 10.666, mito 7, cyto_mito 6.166
Family & Domain DBs
Amino Acid Sequences MVKLCHPLSALVALEAMAAPLHLKESHKRHSHSEGALLGIRENRVEDTIPTILGLLEMDTINATGPWYPFLNKISSCHHQDGKLYCLLNGRGSLCSEDRKQETTAVSSHSKIQRHPLDQLTKLRDWECGHNEINHYKKRYLEYETARAKLMAEKGYNLQAKGGKVKDLERELGLDWQTQRIRQQMLDPIIRAKKKERVQLKKDRKRERKKWAKWWKKEQRSRAHGNDKRAEPDIPRVSRDDSIPDSPES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.1
3 0.08
4 0.05
5 0.04
6 0.04
7 0.05
8 0.07
9 0.09
10 0.13
11 0.22
12 0.3
13 0.4
14 0.47
15 0.51
16 0.55
17 0.6
18 0.64
19 0.57
20 0.55
21 0.46
22 0.4
23 0.39
24 0.33
25 0.27
26 0.22
27 0.21
28 0.16
29 0.16
30 0.14
31 0.14
32 0.14
33 0.13
34 0.15
35 0.15
36 0.15
37 0.14
38 0.13
39 0.11
40 0.1
41 0.09
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.06
52 0.06
53 0.08
54 0.09
55 0.11
56 0.13
57 0.15
58 0.19
59 0.18
60 0.21
61 0.26
62 0.3
63 0.34
64 0.36
65 0.37
66 0.34
67 0.38
68 0.38
69 0.35
70 0.34
71 0.29
72 0.25
73 0.26
74 0.25
75 0.22
76 0.2
77 0.18
78 0.15
79 0.16
80 0.17
81 0.15
82 0.18
83 0.18
84 0.22
85 0.23
86 0.24
87 0.25
88 0.25
89 0.25
90 0.23
91 0.22
92 0.21
93 0.2
94 0.19
95 0.23
96 0.25
97 0.26
98 0.25
99 0.33
100 0.34
101 0.35
102 0.38
103 0.39
104 0.39
105 0.41
106 0.46
107 0.41
108 0.36
109 0.36
110 0.32
111 0.3
112 0.27
113 0.28
114 0.26
115 0.25
116 0.25
117 0.25
118 0.27
119 0.28
120 0.33
121 0.32
122 0.32
123 0.3
124 0.32
125 0.33
126 0.34
127 0.34
128 0.36
129 0.36
130 0.42
131 0.44
132 0.42
133 0.39
134 0.36
135 0.31
136 0.27
137 0.25
138 0.2
139 0.17
140 0.17
141 0.18
142 0.24
143 0.26
144 0.22
145 0.22
146 0.21
147 0.22
148 0.26
149 0.26
150 0.22
151 0.22
152 0.25
153 0.28
154 0.28
155 0.29
156 0.23
157 0.24
158 0.22
159 0.24
160 0.22
161 0.19
162 0.17
163 0.21
164 0.22
165 0.22
166 0.25
167 0.25
168 0.27
169 0.25
170 0.29
171 0.3
172 0.34
173 0.35
174 0.33
175 0.35
176 0.4
177 0.42
178 0.4
179 0.39
180 0.42
181 0.46
182 0.54
183 0.58
184 0.62
185 0.7
186 0.78
187 0.84
188 0.85
189 0.89
190 0.91
191 0.92
192 0.92
193 0.93
194 0.93
195 0.93
196 0.93
197 0.94
198 0.94
199 0.94
200 0.93
201 0.94
202 0.94
203 0.94
204 0.94
205 0.93
206 0.92
207 0.9
208 0.89
209 0.88
210 0.88
211 0.83
212 0.82
213 0.81
214 0.74
215 0.7
216 0.63
217 0.56
218 0.48
219 0.52
220 0.52
221 0.46
222 0.45
223 0.44
224 0.45
225 0.45
226 0.43
227 0.39
228 0.35
229 0.37