Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P152

Protein Details
Accession F4P152   
Localization Confidence Low
Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23QQPVRPLQQRRKVKPFDFAKHRAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 9, cyto 8, nucl 6, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR020103  PsdUridine_synth_cat_dom_sf  
IPR001406  PsdUridine_synth_TruA  
IPR020097  PsdUridine_synth_TruA_a/b_dom  
IPR020095  PsdUridine_synth_TruA_C  
IPR020094  TruA/RsuA/RluB/E/F_N  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0009982  F:pseudouridine synthase activity  
GO:0003723  F:RNA binding  
GO:0106029  F:tRNA pseudouridine synthase activity  
GO:1990481  P:mRNA pseudouridine synthesis  
GO:0031119  P:tRNA pseudouridine synthesis  
Pfam View protein in Pfam  
PF01416  PseudoU_synth_1  
Amino Acid Sequences QQPVRPLQQRRKVKPFDFAKHRARHIALKISYIGDKYYGFASASNDSVPTVESYIFKALEVARLIPSDGGACAWSRCGRTDKGVSAFDQVVSVWVRTARPGDRDTLDWDQLPYLNILNRLLPDDIRVLAWSPVDPIFDARFTCSHRKYNYFFDGAGLDLIAMRDAASRFVGTHDCRHICKIDPTKAAREGFFVRTIMECDIVPVPVDGAPDRFHVLVVKGRAFLWHQVRNMMALLFLIGRGMEMPDMISDMLDLTKHAPAAGRPFYEMAPDGPLVLVECAYPPCLVDWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.81
3 0.81
4 0.8
5 0.79
6 0.79
7 0.77
8 0.78
9 0.75
10 0.69
11 0.67
12 0.64
13 0.64
14 0.55
15 0.51
16 0.48
17 0.42
18 0.4
19 0.33
20 0.27
21 0.19
22 0.18
23 0.16
24 0.15
25 0.14
26 0.12
27 0.13
28 0.15
29 0.15
30 0.16
31 0.15
32 0.15
33 0.13
34 0.13
35 0.13
36 0.1
37 0.1
38 0.1
39 0.1
40 0.12
41 0.15
42 0.15
43 0.14
44 0.15
45 0.15
46 0.17
47 0.18
48 0.17
49 0.15
50 0.15
51 0.16
52 0.13
53 0.13
54 0.09
55 0.08
56 0.07
57 0.07
58 0.07
59 0.07
60 0.1
61 0.12
62 0.13
63 0.16
64 0.2
65 0.22
66 0.27
67 0.32
68 0.34
69 0.36
70 0.36
71 0.34
72 0.33
73 0.31
74 0.25
75 0.21
76 0.16
77 0.13
78 0.12
79 0.11
80 0.08
81 0.09
82 0.09
83 0.11
84 0.14
85 0.15
86 0.18
87 0.19
88 0.22
89 0.22
90 0.24
91 0.28
92 0.28
93 0.27
94 0.23
95 0.22
96 0.19
97 0.18
98 0.17
99 0.12
100 0.09
101 0.1
102 0.1
103 0.1
104 0.11
105 0.1
106 0.12
107 0.11
108 0.1
109 0.1
110 0.1
111 0.1
112 0.09
113 0.09
114 0.08
115 0.08
116 0.08
117 0.07
118 0.07
119 0.08
120 0.08
121 0.08
122 0.08
123 0.09
124 0.09
125 0.09
126 0.09
127 0.11
128 0.14
129 0.22
130 0.24
131 0.29
132 0.31
133 0.36
134 0.38
135 0.43
136 0.42
137 0.36
138 0.33
139 0.28
140 0.25
141 0.2
142 0.17
143 0.1
144 0.06
145 0.05
146 0.04
147 0.04
148 0.03
149 0.03
150 0.04
151 0.05
152 0.06
153 0.06
154 0.06
155 0.07
156 0.08
157 0.13
158 0.13
159 0.17
160 0.22
161 0.24
162 0.25
163 0.27
164 0.27
165 0.25
166 0.32
167 0.37
168 0.38
169 0.43
170 0.45
171 0.47
172 0.51
173 0.5
174 0.42
175 0.38
176 0.34
177 0.29
178 0.28
179 0.23
180 0.18
181 0.17
182 0.18
183 0.15
184 0.13
185 0.1
186 0.1
187 0.11
188 0.1
189 0.1
190 0.08
191 0.08
192 0.08
193 0.09
194 0.08
195 0.09
196 0.1
197 0.11
198 0.13
199 0.12
200 0.12
201 0.12
202 0.14
203 0.17
204 0.2
205 0.2
206 0.19
207 0.19
208 0.21
209 0.21
210 0.27
211 0.3
212 0.32
213 0.32
214 0.33
215 0.33
216 0.33
217 0.31
218 0.24
219 0.16
220 0.1
221 0.09
222 0.07
223 0.06
224 0.05
225 0.04
226 0.04
227 0.05
228 0.05
229 0.05
230 0.05
231 0.05
232 0.05
233 0.07
234 0.06
235 0.06
236 0.05
237 0.06
238 0.06
239 0.06
240 0.07
241 0.08
242 0.09
243 0.1
244 0.1
245 0.11
246 0.14
247 0.22
248 0.27
249 0.26
250 0.26
251 0.28
252 0.27
253 0.29
254 0.27
255 0.21
256 0.19
257 0.18
258 0.16
259 0.14
260 0.14
261 0.12
262 0.11
263 0.1
264 0.07
265 0.08
266 0.09
267 0.11
268 0.11
269 0.1