Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1FTV4

Protein Details
Accession A0A6G1FTV4    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
23-73STVQTRCASQLQKKRPARFDLSKSVARPTPKSKPSAGKPRRRPNHGPFAAMHydrophilic
85-104REPSRPERRRVSGKRGARSTBasic
NLS Segment(s)
PositionSequence
36-103KRPARFDLSKSVARPTPKSKPSAGKPRRRPNHGPFAAMNQTKPPIIPAAREPSRPERRRVSGKRGARS
Subcellular Location(s) mito 18.5, cyto_mito 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011545  DEAD/DEAH_box_helicase_dom  
IPR014001  Helicase_ATP-bd  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0004386  F:helicase activity  
GO:0016787  F:hydrolase activity  
GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF00270  DEAD  
PF00271  Helicase_C  
PROSITE View protein in PROSITE  
PS51192  HELICASE_ATP_BIND_1  
PS51194  HELICASE_CTER  
Amino Acid Sequences MFRSLSSLCLRCEARFLTHNAQSTVQTRCASQLQKKRPARFDLSKSVARPTPKSKPSAGKPRRRPNHGPFAAMNQTKPPIIPAAREPSRPERRRVSGKRGARSTGRADDFKALKMQRALANVSYERRAVIKDQIRDIGSFEDFSLLPIIKASVGSQALLSMEDASPTPIQKVAIPALLGLDGKKARNLSESHGVEEFLLAAETGSGKTLSYLLPIIHAIKAAEAQEAVRKQTEAEDRKKSENYDPFALPSPEESAAGRPRAIILLPTAELVDQVTSVAKSLCHTIKFRASGISAAYSATVIRNRVFAPGGIDILISTPHLLSSIVETNPEILSKVKHLVFDEADSLMDKSFLPITLPILERCRPSLKQHILCSATIPRGMDSYLRRRMPDIRRLTTPNLHAIPRRVQLGVVEVSKEPYHGNKDLACADAIWNIGKSAVREDFDDVGGSKLLKVIVFVNEREQTVELAKYLGTKGIDAVALNRDAPEMRGGAVLSEFTTEKPGQTTSAKDYDEPAGSTSVVPKLEFNSRGVSKTLSNVKVLVVTDIASRGIDTTAVRNVILYDVPHTTIDFIHRLGRIGRMGRRGRGVVLVGKGDRRDVVKEVREGMFRGQALI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.42
4 0.43
5 0.46
6 0.5
7 0.47
8 0.46
9 0.44
10 0.43
11 0.41
12 0.38
13 0.33
14 0.29
15 0.31
16 0.37
17 0.41
18 0.46
19 0.52
20 0.57
21 0.67
22 0.75
23 0.8
24 0.81
25 0.81
26 0.81
27 0.8
28 0.78
29 0.78
30 0.75
31 0.72
32 0.66
33 0.64
34 0.59
35 0.54
36 0.53
37 0.52
38 0.56
39 0.56
40 0.6
41 0.61
42 0.67
43 0.71
44 0.76
45 0.78
46 0.78
47 0.83
48 0.89
49 0.91
50 0.9
51 0.9
52 0.88
53 0.89
54 0.81
55 0.76
56 0.66
57 0.64
58 0.64
59 0.55
60 0.47
61 0.39
62 0.38
63 0.33
64 0.32
65 0.26
66 0.24
67 0.24
68 0.26
69 0.28
70 0.36
71 0.39
72 0.42
73 0.47
74 0.5
75 0.6
76 0.62
77 0.62
78 0.62
79 0.67
80 0.75
81 0.77
82 0.77
83 0.75
84 0.79
85 0.81
86 0.77
87 0.73
88 0.67
89 0.64
90 0.61
91 0.6
92 0.56
93 0.48
94 0.46
95 0.48
96 0.44
97 0.41
98 0.41
99 0.33
100 0.33
101 0.34
102 0.36
103 0.32
104 0.33
105 0.34
106 0.29
107 0.33
108 0.31
109 0.32
110 0.29
111 0.26
112 0.23
113 0.22
114 0.21
115 0.19
116 0.25
117 0.3
118 0.32
119 0.35
120 0.39
121 0.39
122 0.37
123 0.36
124 0.3
125 0.24
126 0.2
127 0.16
128 0.14
129 0.13
130 0.13
131 0.14
132 0.11
133 0.1
134 0.09
135 0.1
136 0.08
137 0.08
138 0.08
139 0.1
140 0.1
141 0.11
142 0.1
143 0.1
144 0.1
145 0.1
146 0.1
147 0.07
148 0.07
149 0.07
150 0.07
151 0.09
152 0.1
153 0.1
154 0.11
155 0.1
156 0.11
157 0.12
158 0.15
159 0.14
160 0.14
161 0.14
162 0.13
163 0.12
164 0.13
165 0.11
166 0.08
167 0.11
168 0.12
169 0.13
170 0.15
171 0.16
172 0.16
173 0.2
174 0.21
175 0.22
176 0.3
177 0.3
178 0.3
179 0.3
180 0.29
181 0.25
182 0.23
183 0.18
184 0.08
185 0.07
186 0.04
187 0.04
188 0.04
189 0.04
190 0.04
191 0.05
192 0.05
193 0.04
194 0.05
195 0.06
196 0.06
197 0.07
198 0.08
199 0.07
200 0.08
201 0.09
202 0.1
203 0.09
204 0.1
205 0.09
206 0.08
207 0.1
208 0.09
209 0.08
210 0.07
211 0.08
212 0.12
213 0.13
214 0.14
215 0.13
216 0.13
217 0.13
218 0.18
219 0.27
220 0.3
221 0.36
222 0.43
223 0.45
224 0.5
225 0.51
226 0.49
227 0.48
228 0.47
229 0.44
230 0.4
231 0.38
232 0.35
233 0.36
234 0.33
235 0.25
236 0.19
237 0.17
238 0.14
239 0.14
240 0.12
241 0.13
242 0.16
243 0.17
244 0.16
245 0.14
246 0.13
247 0.13
248 0.13
249 0.1
250 0.07
251 0.07
252 0.07
253 0.07
254 0.07
255 0.06
256 0.06
257 0.06
258 0.05
259 0.04
260 0.04
261 0.04
262 0.04
263 0.04
264 0.05
265 0.05
266 0.05
267 0.09
268 0.11
269 0.14
270 0.15
271 0.18
272 0.23
273 0.24
274 0.24
275 0.22
276 0.2
277 0.18
278 0.18
279 0.15
280 0.11
281 0.09
282 0.09
283 0.07
284 0.07
285 0.07
286 0.08
287 0.08
288 0.08
289 0.1
290 0.1
291 0.12
292 0.12
293 0.1
294 0.11
295 0.11
296 0.1
297 0.09
298 0.08
299 0.07
300 0.07
301 0.07
302 0.04
303 0.04
304 0.03
305 0.03
306 0.04
307 0.04
308 0.04
309 0.06
310 0.1
311 0.09
312 0.1
313 0.1
314 0.11
315 0.11
316 0.11
317 0.09
318 0.06
319 0.07
320 0.08
321 0.13
322 0.13
323 0.14
324 0.15
325 0.17
326 0.17
327 0.17
328 0.17
329 0.12
330 0.11
331 0.1
332 0.1
333 0.07
334 0.07
335 0.06
336 0.06
337 0.06
338 0.06
339 0.06
340 0.06
341 0.08
342 0.1
343 0.12
344 0.13
345 0.16
346 0.18
347 0.19
348 0.21
349 0.24
350 0.23
351 0.28
352 0.36
353 0.41
354 0.45
355 0.47
356 0.51
357 0.48
358 0.46
359 0.43
360 0.36
361 0.28
362 0.24
363 0.21
364 0.15
365 0.14
366 0.14
367 0.16
368 0.18
369 0.25
370 0.32
371 0.33
372 0.33
373 0.35
374 0.44
375 0.47
376 0.52
377 0.52
378 0.48
379 0.51
380 0.55
381 0.57
382 0.53
383 0.47
384 0.44
385 0.38
386 0.37
387 0.35
388 0.35
389 0.36
390 0.33
391 0.32
392 0.26
393 0.23
394 0.21
395 0.22
396 0.21
397 0.16
398 0.15
399 0.14
400 0.15
401 0.15
402 0.15
403 0.13
404 0.13
405 0.18
406 0.19
407 0.21
408 0.2
409 0.23
410 0.24
411 0.24
412 0.2
413 0.15
414 0.14
415 0.13
416 0.12
417 0.1
418 0.09
419 0.08
420 0.09
421 0.1
422 0.1
423 0.13
424 0.15
425 0.15
426 0.16
427 0.19
428 0.19
429 0.19
430 0.19
431 0.15
432 0.13
433 0.13
434 0.12
435 0.09
436 0.09
437 0.09
438 0.08
439 0.09
440 0.1
441 0.15
442 0.17
443 0.18
444 0.22
445 0.24
446 0.24
447 0.25
448 0.23
449 0.19
450 0.18
451 0.18
452 0.13
453 0.11
454 0.11
455 0.11
456 0.11
457 0.13
458 0.11
459 0.1
460 0.1
461 0.11
462 0.12
463 0.1
464 0.12
465 0.12
466 0.12
467 0.12
468 0.12
469 0.12
470 0.11
471 0.12
472 0.12
473 0.1
474 0.1
475 0.11
476 0.1
477 0.1
478 0.1
479 0.09
480 0.08
481 0.09
482 0.09
483 0.08
484 0.14
485 0.13
486 0.14
487 0.15
488 0.16
489 0.18
490 0.2
491 0.24
492 0.24
493 0.3
494 0.31
495 0.29
496 0.31
497 0.32
498 0.31
499 0.28
500 0.23
501 0.18
502 0.18
503 0.18
504 0.18
505 0.17
506 0.16
507 0.16
508 0.16
509 0.18
510 0.25
511 0.26
512 0.25
513 0.3
514 0.31
515 0.32
516 0.33
517 0.32
518 0.26
519 0.31
520 0.38
521 0.33
522 0.32
523 0.31
524 0.3
525 0.31
526 0.3
527 0.24
528 0.15
529 0.13
530 0.13
531 0.13
532 0.13
533 0.1
534 0.1
535 0.09
536 0.09
537 0.1
538 0.1
539 0.12
540 0.16
541 0.17
542 0.17
543 0.16
544 0.16
545 0.16
546 0.17
547 0.14
548 0.13
549 0.14
550 0.16
551 0.16
552 0.16
553 0.15
554 0.15
555 0.19
556 0.18
557 0.18
558 0.21
559 0.22
560 0.24
561 0.24
562 0.27
563 0.29
564 0.34
565 0.39
566 0.44
567 0.49
568 0.52
569 0.56
570 0.53
571 0.49
572 0.46
573 0.43
574 0.39
575 0.36
576 0.37
577 0.33
578 0.36
579 0.35
580 0.33
581 0.32
582 0.3
583 0.3
584 0.31
585 0.37
586 0.4
587 0.43
588 0.46
589 0.47
590 0.46
591 0.45
592 0.43
593 0.4