Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6G1GES0

Protein Details
Accession A0A6G1GES0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
385-435AEERKMKADREKKEKRDAQLKNMSADEQRKFLEKEREKENRRKSKRQTMRGBasic
NLS Segment(s)
PositionSequence
372-435ESRKIRKATEGEVAEERKMKADREKKEKRDAQLKNMSADEQRKFLEKEREKENRRKSKRQTMRG
Subcellular Location(s) cyto_nucl 12.5, cyto 11.5, nucl 10.5, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR012879  CCDC47  
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
GO:0005509  F:calcium ion binding  
GO:0032469  P:endoplasmic reticulum calcium ion homeostasis  
Pfam View protein in Pfam  
PF07946  CCDC47  
Amino Acid Sequences MADIIKGLFGGGKAQQSPLSSADDDFADFAGVPDPSPVSIPISSPSFSPAKPSLGLATGPYPYTKWYRVWERASPSDFILEAIIIPVIAIVVLIHFWGKRRNQRTAHAWIKAHAPVLKKEFASVGFEGRKKDDELDDSELVDPAKLLKTKAFNEYTTYATGRQNVAFVDIRITLLKWYNPAVIAGENLVNLFFESLEATQERVQANLYCFDGKESQLAPGLAGKTPNSTFDGFVWAIVHKDAMRRLREGQYDLSLTTTKEHPKLPNWATIMTESAEITDTLLTPELIKAVEQAGDSLEALIISDQPIEQPTKLEELTSRKRVSINMRLPSSGDYAPTIPLFHYFLRLPDLLVSSARFRPEVMRRVKQTREEESRKIRKATEGEVAEERKMKADREKKEKRDAQLKNMSADEQRKFLEKEREKENRRKSKRQTMRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.24
4 0.27
5 0.26
6 0.27
7 0.24
8 0.23
9 0.23
10 0.21
11 0.19
12 0.17
13 0.14
14 0.1
15 0.09
16 0.09
17 0.1
18 0.09
19 0.09
20 0.1
21 0.1
22 0.1
23 0.11
24 0.12
25 0.13
26 0.14
27 0.15
28 0.17
29 0.19
30 0.19
31 0.18
32 0.22
33 0.21
34 0.21
35 0.26
36 0.26
37 0.26
38 0.27
39 0.28
40 0.26
41 0.24
42 0.25
43 0.2
44 0.2
45 0.17
46 0.17
47 0.17
48 0.15
49 0.17
50 0.22
51 0.24
52 0.25
53 0.32
54 0.41
55 0.49
56 0.55
57 0.58
58 0.6
59 0.64
60 0.63
61 0.56
62 0.47
63 0.41
64 0.34
65 0.28
66 0.21
67 0.13
68 0.1
69 0.08
70 0.07
71 0.05
72 0.05
73 0.04
74 0.03
75 0.03
76 0.03
77 0.02
78 0.02
79 0.03
80 0.03
81 0.04
82 0.05
83 0.07
84 0.15
85 0.23
86 0.33
87 0.39
88 0.49
89 0.53
90 0.61
91 0.66
92 0.69
93 0.69
94 0.66
95 0.6
96 0.53
97 0.51
98 0.45
99 0.41
100 0.34
101 0.3
102 0.28
103 0.33
104 0.34
105 0.3
106 0.29
107 0.27
108 0.25
109 0.27
110 0.22
111 0.23
112 0.24
113 0.27
114 0.28
115 0.28
116 0.29
117 0.26
118 0.27
119 0.24
120 0.23
121 0.25
122 0.29
123 0.27
124 0.26
125 0.25
126 0.23
127 0.2
128 0.17
129 0.12
130 0.08
131 0.11
132 0.11
133 0.11
134 0.15
135 0.2
136 0.23
137 0.3
138 0.32
139 0.29
140 0.32
141 0.33
142 0.31
143 0.28
144 0.27
145 0.23
146 0.21
147 0.23
148 0.2
149 0.19
150 0.17
151 0.15
152 0.18
153 0.15
154 0.14
155 0.13
156 0.12
157 0.12
158 0.12
159 0.12
160 0.1
161 0.11
162 0.11
163 0.11
164 0.12
165 0.12
166 0.12
167 0.12
168 0.11
169 0.1
170 0.09
171 0.08
172 0.07
173 0.06
174 0.06
175 0.06
176 0.05
177 0.04
178 0.04
179 0.03
180 0.03
181 0.04
182 0.04
183 0.06
184 0.06
185 0.07
186 0.08
187 0.12
188 0.12
189 0.11
190 0.12
191 0.13
192 0.14
193 0.14
194 0.14
195 0.11
196 0.11
197 0.12
198 0.13
199 0.11
200 0.12
201 0.11
202 0.11
203 0.12
204 0.12
205 0.1
206 0.11
207 0.12
208 0.1
209 0.1
210 0.09
211 0.1
212 0.11
213 0.12
214 0.13
215 0.13
216 0.13
217 0.12
218 0.17
219 0.14
220 0.14
221 0.13
222 0.11
223 0.1
224 0.1
225 0.1
226 0.06
227 0.09
228 0.13
229 0.18
230 0.2
231 0.22
232 0.26
233 0.31
234 0.32
235 0.33
236 0.3
237 0.26
238 0.25
239 0.23
240 0.21
241 0.16
242 0.14
243 0.13
244 0.15
245 0.17
246 0.19
247 0.23
248 0.25
249 0.28
250 0.37
251 0.37
252 0.39
253 0.37
254 0.35
255 0.32
256 0.29
257 0.27
258 0.18
259 0.16
260 0.1
261 0.09
262 0.09
263 0.07
264 0.07
265 0.06
266 0.06
267 0.06
268 0.06
269 0.06
270 0.06
271 0.06
272 0.06
273 0.06
274 0.06
275 0.06
276 0.06
277 0.08
278 0.07
279 0.07
280 0.07
281 0.08
282 0.08
283 0.07
284 0.06
285 0.04
286 0.05
287 0.05
288 0.04
289 0.04
290 0.04
291 0.04
292 0.05
293 0.07
294 0.09
295 0.09
296 0.1
297 0.11
298 0.14
299 0.14
300 0.15
301 0.17
302 0.24
303 0.32
304 0.39
305 0.39
306 0.37
307 0.39
308 0.43
309 0.48
310 0.49
311 0.5
312 0.49
313 0.5
314 0.48
315 0.48
316 0.45
317 0.4
318 0.3
319 0.23
320 0.17
321 0.16
322 0.17
323 0.17
324 0.15
325 0.11
326 0.13
327 0.15
328 0.13
329 0.16
330 0.15
331 0.16
332 0.2
333 0.2
334 0.19
335 0.18
336 0.19
337 0.17
338 0.17
339 0.18
340 0.17
341 0.19
342 0.2
343 0.18
344 0.18
345 0.25
346 0.32
347 0.4
348 0.45
349 0.51
350 0.57
351 0.64
352 0.7
353 0.71
354 0.7
355 0.71
356 0.72
357 0.71
358 0.73
359 0.76
360 0.79
361 0.76
362 0.73
363 0.66
364 0.63
365 0.6
366 0.56
367 0.54
368 0.46
369 0.43
370 0.46
371 0.46
372 0.41
373 0.4
374 0.36
375 0.32
376 0.33
377 0.33
378 0.37
379 0.44
380 0.51
381 0.58
382 0.69
383 0.71
384 0.8
385 0.83
386 0.82
387 0.83
388 0.81
389 0.8
390 0.8
391 0.75
392 0.68
393 0.62
394 0.56
395 0.52
396 0.53
397 0.45
398 0.38
399 0.37
400 0.38
401 0.4
402 0.45
403 0.49
404 0.5
405 0.54
406 0.6
407 0.7
408 0.73
409 0.8
410 0.84
411 0.84
412 0.85
413 0.89
414 0.89
415 0.9