Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1FWU7

Protein Details
Accession A0A6G1FWU7    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
175-194GQQGRKKRGRPTKLEAQRRABasic
NLS Segment(s)
PositionSequence
178-200GRKKRGRPTKLEAQRRAEAVARG
Subcellular Location(s) nucl 13, mito 6, plas 3, extr 3
Family & Domain DBs
Amino Acid Sequences MERPSSRERQWTNPEIVDLLAEIIKAGTVAPEILFRFVQDIGIQPKWEDIPLPQGRSLNQCRQLFDTLRVHIPYSAPPGFPSSPYGSSGPLARPGSPSRKRPLAPDTTGPLLPPQVTGGGRPLQPKPQPQPHAPLHSQHGHQLQALPSPDRARAGIGASAPPYALSPAPHSEASGQQGRKKRGRPTKLEAQRRAEAVARGEIPPGQPRSAKKIMTSPPSGTDALPSAGLSPALGGSIGGGHLSATSSATSPLPSAELGQESPAILERQRLSDLFRERQRELDREHERDPWRASLGGGTGVGLGASAGPSLIPTPNIPHEGNEPPAGVGPGQRMSQPGMPSTGVGASPAGAQGPSSKIYNENGKRNGMSRSITPTLSLLDRTSDEKSRSDSLRPDEIMSKRPLSEPPTNYSQEPIMTLIPSHEHSNESYGSLNPRRPIMQHRPFHWQPLRRMATRQHTTPSRFDDAETSTDYDPYHTSITPNCPLLDSNNARPVRVGAWGNTTFCLGLDTLSNEETTPAYDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.48
3 0.42
4 0.33
5 0.23
6 0.18
7 0.12
8 0.09
9 0.08
10 0.07
11 0.06
12 0.06
13 0.06
14 0.05
15 0.05
16 0.06
17 0.07
18 0.11
19 0.12
20 0.14
21 0.14
22 0.14
23 0.15
24 0.15
25 0.15
26 0.12
27 0.17
28 0.21
29 0.23
30 0.24
31 0.22
32 0.24
33 0.24
34 0.24
35 0.2
36 0.15
37 0.24
38 0.29
39 0.32
40 0.33
41 0.34
42 0.36
43 0.44
44 0.5
45 0.49
46 0.52
47 0.52
48 0.51
49 0.54
50 0.58
51 0.51
52 0.51
53 0.47
54 0.42
55 0.44
56 0.42
57 0.39
58 0.34
59 0.32
60 0.29
61 0.3
62 0.29
63 0.25
64 0.24
65 0.3
66 0.29
67 0.29
68 0.3
69 0.27
70 0.26
71 0.29
72 0.29
73 0.24
74 0.25
75 0.27
76 0.23
77 0.26
78 0.26
79 0.24
80 0.27
81 0.32
82 0.42
83 0.46
84 0.52
85 0.52
86 0.59
87 0.59
88 0.61
89 0.63
90 0.61
91 0.58
92 0.56
93 0.53
94 0.48
95 0.47
96 0.41
97 0.34
98 0.26
99 0.22
100 0.17
101 0.13
102 0.14
103 0.14
104 0.14
105 0.17
106 0.19
107 0.22
108 0.25
109 0.27
110 0.32
111 0.37
112 0.45
113 0.5
114 0.56
115 0.59
116 0.59
117 0.65
118 0.63
119 0.66
120 0.6
121 0.54
122 0.5
123 0.49
124 0.46
125 0.43
126 0.4
127 0.33
128 0.31
129 0.31
130 0.26
131 0.25
132 0.26
133 0.22
134 0.21
135 0.22
136 0.22
137 0.2
138 0.2
139 0.16
140 0.16
141 0.15
142 0.15
143 0.14
144 0.14
145 0.13
146 0.13
147 0.12
148 0.1
149 0.09
150 0.08
151 0.08
152 0.08
153 0.11
154 0.13
155 0.16
156 0.16
157 0.16
158 0.17
159 0.18
160 0.21
161 0.25
162 0.25
163 0.28
164 0.35
165 0.42
166 0.48
167 0.52
168 0.58
169 0.62
170 0.69
171 0.71
172 0.72
173 0.75
174 0.78
175 0.82
176 0.79
177 0.75
178 0.69
179 0.61
180 0.55
181 0.46
182 0.39
183 0.3
184 0.25
185 0.2
186 0.17
187 0.17
188 0.16
189 0.15
190 0.18
191 0.19
192 0.18
193 0.2
194 0.22
195 0.3
196 0.34
197 0.34
198 0.3
199 0.36
200 0.4
201 0.42
202 0.43
203 0.36
204 0.33
205 0.35
206 0.35
207 0.26
208 0.22
209 0.17
210 0.14
211 0.13
212 0.1
213 0.08
214 0.07
215 0.07
216 0.05
217 0.04
218 0.04
219 0.04
220 0.03
221 0.03
222 0.02
223 0.03
224 0.03
225 0.03
226 0.02
227 0.02
228 0.03
229 0.03
230 0.03
231 0.03
232 0.04
233 0.04
234 0.05
235 0.06
236 0.06
237 0.06
238 0.06
239 0.06
240 0.06
241 0.06
242 0.06
243 0.07
244 0.07
245 0.07
246 0.07
247 0.06
248 0.06
249 0.07
250 0.07
251 0.06
252 0.09
253 0.09
254 0.11
255 0.12
256 0.12
257 0.13
258 0.19
259 0.24
260 0.27
261 0.32
262 0.35
263 0.34
264 0.41
265 0.42
266 0.4
267 0.37
268 0.41
269 0.43
270 0.42
271 0.44
272 0.45
273 0.43
274 0.44
275 0.43
276 0.34
277 0.29
278 0.25
279 0.23
280 0.17
281 0.15
282 0.11
283 0.09
284 0.07
285 0.06
286 0.05
287 0.05
288 0.04
289 0.03
290 0.02
291 0.02
292 0.02
293 0.02
294 0.02
295 0.02
296 0.03
297 0.04
298 0.05
299 0.05
300 0.08
301 0.11
302 0.15
303 0.15
304 0.15
305 0.19
306 0.21
307 0.22
308 0.21
309 0.19
310 0.15
311 0.15
312 0.14
313 0.1
314 0.09
315 0.09
316 0.1
317 0.11
318 0.11
319 0.12
320 0.14
321 0.17
322 0.17
323 0.16
324 0.16
325 0.16
326 0.15
327 0.15
328 0.13
329 0.09
330 0.09
331 0.08
332 0.06
333 0.06
334 0.06
335 0.05
336 0.04
337 0.05
338 0.06
339 0.08
340 0.09
341 0.1
342 0.11
343 0.13
344 0.16
345 0.26
346 0.31
347 0.37
348 0.39
349 0.41
350 0.42
351 0.42
352 0.43
353 0.36
354 0.32
355 0.26
356 0.3
357 0.3
358 0.29
359 0.27
360 0.24
361 0.22
362 0.21
363 0.2
364 0.13
365 0.12
366 0.14
367 0.16
368 0.19
369 0.22
370 0.23
371 0.24
372 0.27
373 0.31
374 0.32
375 0.34
376 0.36
377 0.37
378 0.41
379 0.4
380 0.38
381 0.4
382 0.4
383 0.42
384 0.4
385 0.37
386 0.32
387 0.33
388 0.35
389 0.35
390 0.41
391 0.38
392 0.4
393 0.44
394 0.45
395 0.43
396 0.41
397 0.35
398 0.27
399 0.25
400 0.21
401 0.16
402 0.13
403 0.13
404 0.12
405 0.13
406 0.14
407 0.16
408 0.15
409 0.15
410 0.16
411 0.19
412 0.19
413 0.18
414 0.17
415 0.17
416 0.24
417 0.28
418 0.31
419 0.3
420 0.32
421 0.33
422 0.35
423 0.43
424 0.46
425 0.51
426 0.54
427 0.55
428 0.62
429 0.62
430 0.69
431 0.68
432 0.64
433 0.62
434 0.65
435 0.68
436 0.61
437 0.65
438 0.64
439 0.66
440 0.64
441 0.61
442 0.59
443 0.6
444 0.62
445 0.63
446 0.61
447 0.57
448 0.51
449 0.48
450 0.44
451 0.39
452 0.37
453 0.33
454 0.3
455 0.24
456 0.25
457 0.24
458 0.22
459 0.2
460 0.19
461 0.19
462 0.16
463 0.18
464 0.22
465 0.29
466 0.32
467 0.33
468 0.31
469 0.29
470 0.3
471 0.31
472 0.36
473 0.35
474 0.37
475 0.44
476 0.44
477 0.43
478 0.43
479 0.41
480 0.32
481 0.33
482 0.29
483 0.22
484 0.3
485 0.33
486 0.33
487 0.32
488 0.31
489 0.24
490 0.21
491 0.21
492 0.13
493 0.1
494 0.11
495 0.13
496 0.15
497 0.15
498 0.16
499 0.14
500 0.15
501 0.15