Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1FZ90

Protein Details
Accession A0A6G1FZ90    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
77-116EASRSAIKRDRQSKKKSSRAKKSRRKYRKLEEEKSRQEGGBasic
NLS Segment(s)
PositionSequence
79-107SRSAIKRDRQSKKKSSRAKKSRRKYRKLE
Subcellular Location(s) nucl 22.5, cyto_nucl 14.333, mito_nucl 12.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR000352  Pep_chain_release_fac_I  
IPR045853  Pep_chain_release_fac_I_sf  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0016787  F:hydrolase activity  
GO:0003747  F:translation release factor activity  
Pfam View protein in Pfam  
PF00472  RF-1  
Amino Acid Sequences KPLPPKPTVDDNDLIENFLRGSGPGGQKINKTTSAVQLIHIPTGLVVKSQDTRSRSQNRVIARKRLAEALDEREHGEASRSAIKRDRQSKKKSSRAKKSRRKYRKLEEEKSRQEGGAAVGEEDGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.3
3 0.26
4 0.2
5 0.16
6 0.14
7 0.07
8 0.09
9 0.14
10 0.17
11 0.21
12 0.24
13 0.26
14 0.29
15 0.33
16 0.34
17 0.3
18 0.3
19 0.28
20 0.3
21 0.33
22 0.31
23 0.28
24 0.29
25 0.28
26 0.25
27 0.23
28 0.17
29 0.11
30 0.12
31 0.11
32 0.06
33 0.06
34 0.08
35 0.11
36 0.13
37 0.18
38 0.2
39 0.23
40 0.31
41 0.39
42 0.4
43 0.43
44 0.44
45 0.46
46 0.53
47 0.54
48 0.53
49 0.48
50 0.48
51 0.43
52 0.42
53 0.36
54 0.28
55 0.27
56 0.25
57 0.24
58 0.22
59 0.22
60 0.19
61 0.19
62 0.16
63 0.15
64 0.1
65 0.11
66 0.18
67 0.18
68 0.2
69 0.26
70 0.31
71 0.38
72 0.48
73 0.56
74 0.58
75 0.67
76 0.76
77 0.8
78 0.85
79 0.87
80 0.87
81 0.88
82 0.9
83 0.92
84 0.92
85 0.92
86 0.94
87 0.95
88 0.94
89 0.93
90 0.93
91 0.93
92 0.93
93 0.92
94 0.91
95 0.91
96 0.89
97 0.85
98 0.75
99 0.64
100 0.53
101 0.45
102 0.36
103 0.3
104 0.22
105 0.17