Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1GH12

Protein Details
Accession A0A6G1GH12    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
56-79ATPNVKKATKRTPSSKKRARTATPHydrophilic
NLS Segment(s)
PositionSequence
62-74KATKRTPSSKKRA
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences IDMKKFAQLAGYTEGSARNAFAAVRKKLRAVAQSKSTNGGTNSPTASNNKAGTGVATPNVKKATKRTPSSKKRARTATPSDLDDDEDTPSKRPRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.18
4 0.15
5 0.1
6 0.09
7 0.09
8 0.14
9 0.21
10 0.26
11 0.31
12 0.32
13 0.33
14 0.37
15 0.41
16 0.43
17 0.4
18 0.4
19 0.43
20 0.46
21 0.45
22 0.44
23 0.4
24 0.35
25 0.31
26 0.28
27 0.21
28 0.18
29 0.18
30 0.16
31 0.17
32 0.16
33 0.18
34 0.18
35 0.17
36 0.15
37 0.15
38 0.14
39 0.13
40 0.12
41 0.11
42 0.1
43 0.13
44 0.12
45 0.15
46 0.19
47 0.2
48 0.2
49 0.26
50 0.34
51 0.4
52 0.47
53 0.55
54 0.62
55 0.71
56 0.81
57 0.83
58 0.81
59 0.81
60 0.83
61 0.79
62 0.78
63 0.76
64 0.75
65 0.7
66 0.64
67 0.58
68 0.5
69 0.46
70 0.38
71 0.3
72 0.24
73 0.24
74 0.23
75 0.24