Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P4L8

Protein Details
Accession F4P4L8    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
101-120QVIKYKKKLRWISNNLRKKAHydrophilic
187-210RGGRGRGGRGRSRSRSRSRSPRRSBasic
NLS Segment(s)
PositionSequence
183-210GGRGRGGRGRGGRGRSRSRSRSRSPRRS
Subcellular Location(s) extr 16, mito 6, plas 2, pero 1, E.R. 1, golg 1
Family & Domain DBs
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MRLLVAILTSILLACSVIAAPPDGSRRLIPYRIDVITGNPGYVIKRYAIARQNHMQSKKAVELAVATYEDQKALITTLEESGYKPEYLKYERILLTKLEFQVIKYKKKLRWISNNLRKKAGELVEYFYGNQKPESIGYRIKCLQATPIIRDYIRDFYKGPLEAPKITSDGGSQQQGPSQSHGGGRGRGGRGRGGRGRSRSRSRSRSPRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.05
5 0.05
6 0.07
7 0.07
8 0.1
9 0.14
10 0.16
11 0.18
12 0.18
13 0.24
14 0.28
15 0.32
16 0.31
17 0.33
18 0.37
19 0.35
20 0.35
21 0.3
22 0.27
23 0.3
24 0.28
25 0.23
26 0.18
27 0.18
28 0.17
29 0.18
30 0.17
31 0.1
32 0.14
33 0.15
34 0.22
35 0.29
36 0.32
37 0.37
38 0.42
39 0.5
40 0.53
41 0.55
42 0.5
43 0.45
44 0.45
45 0.41
46 0.37
47 0.29
48 0.22
49 0.2
50 0.18
51 0.17
52 0.14
53 0.11
54 0.1
55 0.1
56 0.1
57 0.09
58 0.08
59 0.06
60 0.06
61 0.06
62 0.05
63 0.06
64 0.07
65 0.07
66 0.08
67 0.08
68 0.1
69 0.11
70 0.11
71 0.1
72 0.11
73 0.14
74 0.17
75 0.2
76 0.19
77 0.23
78 0.25
79 0.25
80 0.25
81 0.22
82 0.2
83 0.21
84 0.2
85 0.16
86 0.14
87 0.14
88 0.22
89 0.26
90 0.29
91 0.31
92 0.38
93 0.39
94 0.48
95 0.56
96 0.55
97 0.62
98 0.67
99 0.72
100 0.76
101 0.82
102 0.74
103 0.7
104 0.62
105 0.52
106 0.48
107 0.39
108 0.32
109 0.24
110 0.26
111 0.23
112 0.24
113 0.23
114 0.2
115 0.19
116 0.16
117 0.15
118 0.12
119 0.12
120 0.13
121 0.16
122 0.17
123 0.21
124 0.21
125 0.27
126 0.28
127 0.29
128 0.28
129 0.25
130 0.25
131 0.26
132 0.28
133 0.27
134 0.28
135 0.28
136 0.27
137 0.29
138 0.28
139 0.29
140 0.28
141 0.26
142 0.23
143 0.24
144 0.29
145 0.28
146 0.26
147 0.25
148 0.28
149 0.28
150 0.29
151 0.28
152 0.24
153 0.24
154 0.23
155 0.17
156 0.18
157 0.2
158 0.2
159 0.19
160 0.18
161 0.21
162 0.24
163 0.25
164 0.24
165 0.22
166 0.22
167 0.22
168 0.28
169 0.28
170 0.27
171 0.29
172 0.32
173 0.33
174 0.35
175 0.35
176 0.37
177 0.38
178 0.44
179 0.48
180 0.49
181 0.54
182 0.6
183 0.68
184 0.7
185 0.76
186 0.78
187 0.82
188 0.84
189 0.86
190 0.88