Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6G1GEY4

Protein Details
Accession A0A6G1GEY4    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
105-124LSHLHHRSPQQTRPRLPRRMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 12.5, mito 4
Family & Domain DBs
Amino Acid Sequences MHQEPQNHTLPSYTPIPLPPNLPHPLHHPSIQRPRKPMYLAQMLQQLILPHKCPLPLLPRRTVQRPVLRLQMPPRRFSLPTKHTTPPPSSFSSYPILPTHLPHPLSHLHHRSPQQTRPRLPRRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.26
4 0.26
5 0.28
6 0.27
7 0.3
8 0.34
9 0.33
10 0.31
11 0.33
12 0.37
13 0.36
14 0.38
15 0.37
16 0.41
17 0.51
18 0.59
19 0.58
20 0.58
21 0.6
22 0.6
23 0.59
24 0.53
25 0.5
26 0.5
27 0.45
28 0.43
29 0.43
30 0.38
31 0.34
32 0.31
33 0.24
34 0.18
35 0.19
36 0.17
37 0.13
38 0.13
39 0.13
40 0.13
41 0.15
42 0.21
43 0.27
44 0.3
45 0.34
46 0.38
47 0.41
48 0.45
49 0.46
50 0.45
51 0.44
52 0.43
53 0.41
54 0.44
55 0.42
56 0.41
57 0.44
58 0.47
59 0.42
60 0.41
61 0.41
62 0.38
63 0.39
64 0.4
65 0.42
66 0.4
67 0.43
68 0.47
69 0.47
70 0.49
71 0.52
72 0.52
73 0.47
74 0.44
75 0.43
76 0.41
77 0.39
78 0.37
79 0.36
80 0.31
81 0.29
82 0.25
83 0.24
84 0.21
85 0.22
86 0.22
87 0.25
88 0.26
89 0.23
90 0.26
91 0.29
92 0.35
93 0.43
94 0.46
95 0.44
96 0.5
97 0.56
98 0.61
99 0.62
100 0.65
101 0.66
102 0.69
103 0.74
104 0.78