Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1GC04

Protein Details
Accession A0A6G1GC04    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
18-38IEKVLRNERKRQEKEVKLLLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 9.5, mito 2, plas 2, E.R. 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002975  Fungi_Gprotein_alpha  
IPR001019  Gprotein_alpha_su  
IPR011025  GproteinA_insert  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005834  C:heterotrimeric G-protein complex  
GO:0001664  F:G protein-coupled receptor binding  
GO:0031683  F:G-protein beta/gamma-subunit complex binding  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0007186  P:G protein-coupled receptor signaling pathway  
Pfam View protein in Pfam  
PF00503  G-alpha  
PROSITE View protein in PROSITE  
PS51882  G_ALPHA  
CDD cd00066  G-alpha  
Amino Acid Sequences MCFGKKPQDPGHRRNEEIEKVLRNERKRQEKEVKLLLLGAGESGKSTVLKQMRVIHTGGFSRNERKQWRAVIFNNLINAFNTIFLVMEEHDEMFEDQANTEYMNKIKGDPEIGPEERMPAEYLVAFNTLWDDRGVQMAMLKGNEYALHDNLSYFFDDVDRLFAPNYLPSDQDILRTRLRTTANPISETIFQLGNLTYRMFDVGGQRSERKKWIHCFDNVQVVLFLVAISGYDLALIEDRSGNQMSEALMLWESIVNSKYFERSAMILFLNKIDLFREKIASGMSPIRKHFPDFNGKPDDIVAGHEFFSNKFKKLVRSQSKEIYVHLTNATDTDLLKKTMQSVQDMIVQRNLNQLIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.72
3 0.67
4 0.64
5 0.62
6 0.57
7 0.54
8 0.61
9 0.61
10 0.59
11 0.63
12 0.66
13 0.71
14 0.71
15 0.77
16 0.78
17 0.8
18 0.82
19 0.8
20 0.73
21 0.62
22 0.57
23 0.47
24 0.36
25 0.27
26 0.19
27 0.11
28 0.08
29 0.07
30 0.07
31 0.07
32 0.07
33 0.08
34 0.15
35 0.19
36 0.21
37 0.26
38 0.35
39 0.38
40 0.4
41 0.41
42 0.35
43 0.34
44 0.35
45 0.33
46 0.29
47 0.29
48 0.34
49 0.39
50 0.45
51 0.47
52 0.49
53 0.52
54 0.56
55 0.58
56 0.58
57 0.56
58 0.57
59 0.56
60 0.53
61 0.49
62 0.42
63 0.37
64 0.29
65 0.27
66 0.18
67 0.14
68 0.12
69 0.09
70 0.08
71 0.07
72 0.08
73 0.06
74 0.08
75 0.08
76 0.08
77 0.08
78 0.09
79 0.09
80 0.08
81 0.1
82 0.08
83 0.08
84 0.09
85 0.09
86 0.09
87 0.1
88 0.11
89 0.1
90 0.12
91 0.13
92 0.13
93 0.14
94 0.15
95 0.17
96 0.16
97 0.19
98 0.22
99 0.22
100 0.23
101 0.21
102 0.22
103 0.2
104 0.2
105 0.17
106 0.11
107 0.1
108 0.09
109 0.09
110 0.08
111 0.09
112 0.08
113 0.07
114 0.08
115 0.08
116 0.08
117 0.08
118 0.08
119 0.07
120 0.09
121 0.09
122 0.07
123 0.08
124 0.09
125 0.1
126 0.09
127 0.09
128 0.08
129 0.08
130 0.08
131 0.09
132 0.1
133 0.1
134 0.11
135 0.1
136 0.1
137 0.11
138 0.12
139 0.1
140 0.08
141 0.07
142 0.07
143 0.07
144 0.07
145 0.09
146 0.08
147 0.08
148 0.08
149 0.08
150 0.08
151 0.1
152 0.12
153 0.1
154 0.1
155 0.1
156 0.13
157 0.13
158 0.17
159 0.18
160 0.19
161 0.21
162 0.22
163 0.21
164 0.24
165 0.26
166 0.23
167 0.27
168 0.31
169 0.3
170 0.31
171 0.31
172 0.28
173 0.27
174 0.26
175 0.2
176 0.13
177 0.11
178 0.1
179 0.1
180 0.08
181 0.08
182 0.08
183 0.06
184 0.06
185 0.07
186 0.06
187 0.07
188 0.11
189 0.14
190 0.16
191 0.18
192 0.23
193 0.25
194 0.27
195 0.32
196 0.32
197 0.36
198 0.42
199 0.48
200 0.48
201 0.49
202 0.52
203 0.49
204 0.53
205 0.46
206 0.38
207 0.3
208 0.25
209 0.21
210 0.15
211 0.13
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.03
218 0.03
219 0.03
220 0.03
221 0.04
222 0.04
223 0.05
224 0.05
225 0.06
226 0.08
227 0.09
228 0.09
229 0.08
230 0.09
231 0.09
232 0.09
233 0.09
234 0.07
235 0.07
236 0.07
237 0.07
238 0.07
239 0.06
240 0.07
241 0.08
242 0.08
243 0.09
244 0.1
245 0.12
246 0.12
247 0.13
248 0.12
249 0.13
250 0.14
251 0.15
252 0.15
253 0.15
254 0.15
255 0.14
256 0.15
257 0.13
258 0.12
259 0.12
260 0.14
261 0.16
262 0.17
263 0.19
264 0.17
265 0.18
266 0.18
267 0.17
268 0.18
269 0.22
270 0.26
271 0.27
272 0.3
273 0.35
274 0.35
275 0.39
276 0.42
277 0.41
278 0.47
279 0.45
280 0.51
281 0.52
282 0.51
283 0.47
284 0.41
285 0.36
286 0.25
287 0.26
288 0.21
289 0.15
290 0.15
291 0.17
292 0.17
293 0.16
294 0.24
295 0.24
296 0.23
297 0.28
298 0.31
299 0.37
300 0.47
301 0.57
302 0.59
303 0.64
304 0.7
305 0.73
306 0.78
307 0.7
308 0.63
309 0.58
310 0.49
311 0.43
312 0.38
313 0.3
314 0.22
315 0.22
316 0.21
317 0.15
318 0.14
319 0.17
320 0.18
321 0.2
322 0.21
323 0.21
324 0.24
325 0.28
326 0.3
327 0.29
328 0.28
329 0.28
330 0.34
331 0.37
332 0.35
333 0.36
334 0.35
335 0.31
336 0.37