Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6G1FY32

Protein Details
Accession A0A6G1FY32    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
17-40PAGKAPAEKKEKRTKTRKETYSSYHydrophilic
NLS Segment(s)
PositionSequence
13-34GGKAPAGKAPAEKKEKRTKTRK
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MAPKAAQKTPSTGGKAPAGKAPAEKKEKRTKTRKETYSSYIYKVLKQVHPDTGISNRAMSILNSFVNDIFERVATEASKLAAYNKKSTISSREIQTSVRLILPGELAKHAVSEGTKAVTKYSSASK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.46
3 0.42
4 0.4
5 0.35
6 0.31
7 0.34
8 0.37
9 0.39
10 0.45
11 0.49
12 0.54
13 0.63
14 0.72
15 0.76
16 0.8
17 0.82
18 0.83
19 0.88
20 0.86
21 0.82
22 0.78
23 0.74
24 0.72
25 0.64
26 0.56
27 0.52
28 0.46
29 0.41
30 0.4
31 0.4
32 0.33
33 0.36
34 0.36
35 0.32
36 0.33
37 0.32
38 0.28
39 0.26
40 0.26
41 0.21
42 0.18
43 0.14
44 0.13
45 0.13
46 0.11
47 0.09
48 0.08
49 0.08
50 0.08
51 0.08
52 0.07
53 0.09
54 0.08
55 0.08
56 0.06
57 0.06
58 0.06
59 0.07
60 0.07
61 0.06
62 0.07
63 0.07
64 0.07
65 0.07
66 0.07
67 0.11
68 0.16
69 0.19
70 0.22
71 0.24
72 0.26
73 0.27
74 0.29
75 0.31
76 0.31
77 0.33
78 0.32
79 0.34
80 0.33
81 0.33
82 0.33
83 0.29
84 0.25
85 0.21
86 0.18
87 0.14
88 0.14
89 0.15
90 0.14
91 0.13
92 0.12
93 0.13
94 0.12
95 0.12
96 0.11
97 0.11
98 0.1
99 0.11
100 0.11
101 0.13
102 0.16
103 0.16
104 0.18
105 0.17
106 0.18