Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1GEQ3

Protein Details
Accession A0A6G1GEQ3    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
95-115RGERHEKKVHKDERQALRGRKBasic
NLS Segment(s)
Subcellular Location(s) cyto 13, mito 10, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR000266  Ribosomal_S17/S11  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00366  Ribosomal_S17  
Amino Acid Sequences VGVVVSAGKMDKCVKVRIPKQVWNNKIRKYFTEHYALLVSDPANSTRAGDVVRIRDGYRPATRAARVAHIVTNVISPFGPPLGDRAPVPSDEELRGERHEKKVHKDERQALRGRKLALERV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.44
3 0.51
4 0.58
5 0.63
6 0.65
7 0.72
8 0.76
9 0.77
10 0.77
11 0.78
12 0.75
13 0.76
14 0.72
15 0.64
16 0.63
17 0.59
18 0.54
19 0.53
20 0.45
21 0.39
22 0.36
23 0.33
24 0.25
25 0.21
26 0.16
27 0.1
28 0.1
29 0.09
30 0.09
31 0.09
32 0.09
33 0.08
34 0.09
35 0.09
36 0.1
37 0.12
38 0.13
39 0.15
40 0.15
41 0.15
42 0.17
43 0.19
44 0.21
45 0.21
46 0.2
47 0.21
48 0.23
49 0.23
50 0.23
51 0.23
52 0.2
53 0.2
54 0.19
55 0.18
56 0.16
57 0.16
58 0.12
59 0.13
60 0.1
61 0.09
62 0.07
63 0.06
64 0.06
65 0.06
66 0.06
67 0.05
68 0.09
69 0.1
70 0.11
71 0.11
72 0.14
73 0.16
74 0.16
75 0.19
76 0.17
77 0.18
78 0.18
79 0.21
80 0.19
81 0.19
82 0.22
83 0.25
84 0.28
85 0.33
86 0.4
87 0.44
88 0.51
89 0.6
90 0.66
91 0.7
92 0.75
93 0.77
94 0.79
95 0.83
96 0.82
97 0.79
98 0.78
99 0.73
100 0.66
101 0.62