Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P811

Protein Details
Accession F4P811    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
64-93APAIRHQQPVRRPRKQRQQVFRSRPQSQRAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 14.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008978  HSP20-like_chaperone  
CDD cd00298  ACD_sHsps_p23-like  
Amino Acid Sequences MLRFATFPQSVYYEPPIYRLVQQDDSDQDDSAFVSDYPIRYCRNCRAPSQTPGLQPIYITDGSAPAIRHQQPVRRPRKQRQQVFRSRPQSQRASISDSPLFQDLFETDRDVTDSARLDVWDLLHEILGDSTKQKHPQVRPDHKIKSKTEATPVSNLIRINIVDREPAGKSDTVEPVHVETTTQLDNVDSHLNSESAGDEHNETAASMEIDKEPDAETSLLQPDPSVDQPVDQPSDQLAQSPPSEWTSIDHLEPTLLSISQNKHPVQEAAQETDTAYIYRMQIPDGVTQGMLDVQVDEVSRLTHIKTPGEFSKSIQLPDNADLSSLSATIGSSDNILEIVLDKMSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.31
3 0.31
4 0.3
5 0.33
6 0.34
7 0.35
8 0.35
9 0.36
10 0.38
11 0.38
12 0.42
13 0.39
14 0.33
15 0.27
16 0.21
17 0.2
18 0.16
19 0.14
20 0.08
21 0.1
22 0.13
23 0.14
24 0.17
25 0.21
26 0.24
27 0.27
28 0.34
29 0.4
30 0.48
31 0.51
32 0.54
33 0.6
34 0.63
35 0.65
36 0.67
37 0.63
38 0.56
39 0.58
40 0.53
41 0.44
42 0.36
43 0.31
44 0.29
45 0.23
46 0.2
47 0.14
48 0.13
49 0.14
50 0.16
51 0.15
52 0.12
53 0.21
54 0.22
55 0.29
56 0.32
57 0.39
58 0.45
59 0.56
60 0.64
61 0.66
62 0.74
63 0.78
64 0.85
65 0.88
66 0.9
67 0.9
68 0.9
69 0.91
70 0.91
71 0.9
72 0.87
73 0.85
74 0.81
75 0.78
76 0.74
77 0.66
78 0.64
79 0.57
80 0.57
81 0.5
82 0.48
83 0.42
84 0.36
85 0.34
86 0.27
87 0.25
88 0.16
89 0.15
90 0.11
91 0.11
92 0.11
93 0.11
94 0.1
95 0.1
96 0.11
97 0.11
98 0.1
99 0.12
100 0.12
101 0.11
102 0.11
103 0.11
104 0.11
105 0.12
106 0.11
107 0.1
108 0.09
109 0.09
110 0.08
111 0.08
112 0.07
113 0.06
114 0.06
115 0.06
116 0.06
117 0.1
118 0.14
119 0.18
120 0.23
121 0.3
122 0.35
123 0.45
124 0.54
125 0.61
126 0.65
127 0.69
128 0.74
129 0.73
130 0.75
131 0.67
132 0.64
133 0.59
134 0.54
135 0.52
136 0.49
137 0.44
138 0.4
139 0.4
140 0.34
141 0.3
142 0.28
143 0.21
144 0.17
145 0.15
146 0.13
147 0.12
148 0.11
149 0.09
150 0.1
151 0.11
152 0.1
153 0.11
154 0.11
155 0.1
156 0.1
157 0.13
158 0.16
159 0.14
160 0.15
161 0.14
162 0.13
163 0.13
164 0.12
165 0.1
166 0.07
167 0.08
168 0.08
169 0.08
170 0.07
171 0.07
172 0.07
173 0.09
174 0.1
175 0.08
176 0.09
177 0.09
178 0.09
179 0.09
180 0.09
181 0.08
182 0.06
183 0.07
184 0.06
185 0.06
186 0.06
187 0.07
188 0.06
189 0.06
190 0.06
191 0.06
192 0.05
193 0.04
194 0.05
195 0.06
196 0.07
197 0.07
198 0.07
199 0.07
200 0.07
201 0.09
202 0.08
203 0.08
204 0.09
205 0.11
206 0.1
207 0.1
208 0.09
209 0.09
210 0.11
211 0.11
212 0.12
213 0.1
214 0.1
215 0.13
216 0.16
217 0.18
218 0.15
219 0.15
220 0.14
221 0.16
222 0.16
223 0.16
224 0.13
225 0.13
226 0.14
227 0.15
228 0.15
229 0.14
230 0.15
231 0.14
232 0.15
233 0.17
234 0.18
235 0.18
236 0.17
237 0.15
238 0.14
239 0.14
240 0.13
241 0.09
242 0.07
243 0.08
244 0.12
245 0.15
246 0.2
247 0.27
248 0.26
249 0.27
250 0.29
251 0.3
252 0.28
253 0.32
254 0.3
255 0.28
256 0.28
257 0.26
258 0.25
259 0.24
260 0.23
261 0.15
262 0.13
263 0.11
264 0.12
265 0.16
266 0.16
267 0.15
268 0.17
269 0.19
270 0.2
271 0.2
272 0.19
273 0.14
274 0.14
275 0.14
276 0.11
277 0.09
278 0.07
279 0.05
280 0.05
281 0.06
282 0.07
283 0.07
284 0.07
285 0.07
286 0.08
287 0.09
288 0.11
289 0.15
290 0.18
291 0.22
292 0.23
293 0.29
294 0.34
295 0.38
296 0.37
297 0.35
298 0.41
299 0.4
300 0.4
301 0.39
302 0.36
303 0.34
304 0.36
305 0.36
306 0.26
307 0.24
308 0.22
309 0.18
310 0.16
311 0.12
312 0.09
313 0.07
314 0.07
315 0.08
316 0.09
317 0.08
318 0.08
319 0.08
320 0.08
321 0.08
322 0.08
323 0.07
324 0.07
325 0.08