Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6G1FXT1

Protein Details
Accession A0A6G1FXT1    Localization Confidence High Confidence Score 22
NoLS Segment(s)
PositionSequenceProtein Nature
2-27SSRGRGGKFSKPKRGGGRHFNRNLQPBasic
NLS Segment(s)
PositionSequence
5-19GRGGKFSKPKRGGGR
80-90RAAAKARKAAA
183-233LVRERREAEGARRRAEEEERRELEKEKREQMEREERRREAARGPKGKKGKK
Subcellular Location(s) nucl 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR019380  Casein_kinase_sb_PP28  
Pfam View protein in Pfam  
PF10252  PP28  
Amino Acid Sequences MSSRGRGGKFSKPKRGGGRHFNRNLQPVDKNGEAISMWADPADRKDPEDSDDSSEEESSEEESSEDDDQPQSAMTREERRAAAKARKAAAAARSSGRPEVGDLPPNSSEDEDDSDSDMPANPNHTTSARAQASKVAKAPGATPGAVKKAVQVAKAAKAAKKGEDSEEDEGPEEARLEMEKLRLVRERREAEGARRRAEEEERRELEKEKREQMEREERRREAARGPKGKKGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.83
3 0.82
4 0.82
5 0.83
6 0.83
7 0.84
8 0.84
9 0.79
10 0.76
11 0.71
12 0.65
13 0.58
14 0.52
15 0.51
16 0.43
17 0.38
18 0.31
19 0.28
20 0.22
21 0.19
22 0.17
23 0.1
24 0.1
25 0.08
26 0.09
27 0.09
28 0.13
29 0.18
30 0.17
31 0.19
32 0.22
33 0.23
34 0.26
35 0.29
36 0.26
37 0.26
38 0.26
39 0.25
40 0.23
41 0.22
42 0.19
43 0.15
44 0.14
45 0.1
46 0.09
47 0.08
48 0.07
49 0.07
50 0.09
51 0.11
52 0.11
53 0.1
54 0.1
55 0.1
56 0.1
57 0.1
58 0.09
59 0.08
60 0.1
61 0.12
62 0.19
63 0.21
64 0.24
65 0.25
66 0.27
67 0.3
68 0.35
69 0.39
70 0.37
71 0.41
72 0.39
73 0.39
74 0.37
75 0.36
76 0.34
77 0.28
78 0.25
79 0.21
80 0.21
81 0.21
82 0.21
83 0.18
84 0.14
85 0.13
86 0.16
87 0.16
88 0.2
89 0.19
90 0.21
91 0.21
92 0.22
93 0.21
94 0.16
95 0.15
96 0.1
97 0.13
98 0.11
99 0.1
100 0.11
101 0.11
102 0.1
103 0.1
104 0.1
105 0.08
106 0.07
107 0.09
108 0.08
109 0.09
110 0.1
111 0.11
112 0.13
113 0.13
114 0.21
115 0.21
116 0.21
117 0.21
118 0.25
119 0.27
120 0.27
121 0.28
122 0.2
123 0.19
124 0.19
125 0.2
126 0.18
127 0.17
128 0.15
129 0.14
130 0.15
131 0.17
132 0.17
133 0.16
134 0.13
135 0.18
136 0.2
137 0.2
138 0.22
139 0.22
140 0.25
141 0.3
142 0.31
143 0.26
144 0.3
145 0.31
146 0.3
147 0.31
148 0.29
149 0.28
150 0.3
151 0.33
152 0.31
153 0.3
154 0.27
155 0.24
156 0.22
157 0.19
158 0.15
159 0.11
160 0.07
161 0.07
162 0.07
163 0.08
164 0.09
165 0.1
166 0.13
167 0.13
168 0.17
169 0.24
170 0.27
171 0.32
172 0.4
173 0.42
174 0.43
175 0.5
176 0.49
177 0.53
178 0.59
179 0.58
180 0.53
181 0.51
182 0.49
183 0.45
184 0.51
185 0.51
186 0.48
187 0.52
188 0.52
189 0.53
190 0.53
191 0.54
192 0.54
193 0.53
194 0.54
195 0.52
196 0.57
197 0.59
198 0.61
199 0.66
200 0.69
201 0.69
202 0.72
203 0.72
204 0.66
205 0.68
206 0.68
207 0.62
208 0.6
209 0.61
210 0.61
211 0.63
212 0.66
213 0.69