Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1GA99

Protein Details
Accession A0A6G1GA99    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
62-88LAKSPLRPPRRLRPRPRPRPPLVRGSDBasic
NLS Segment(s)
PositionSequence
63-87AKSPLRPPRRLRPRPRPRPPLVRGS
94-102GVRRGSGGG
106-114GYKSGGKRK
Subcellular Location(s) mito 13.5, nucl 9.5, cyto_mito 9.499, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences ASHINSAISARVSHQPRNIPINHNFSFSHHLPSPPPSLVSTPIPPLIPSHHGPQLVHPPPPLAKSPLRPPRRLRPRPRPRPPLVRGSDLLPAAGVRRGSGGGAIAGYKSGGKRKGVLGVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.4
3 0.45
4 0.51
5 0.52
6 0.51
7 0.54
8 0.57
9 0.52
10 0.48
11 0.43
12 0.39
13 0.42
14 0.37
15 0.36
16 0.29
17 0.29
18 0.28
19 0.32
20 0.32
21 0.26
22 0.26
23 0.21
24 0.21
25 0.22
26 0.23
27 0.21
28 0.19
29 0.2
30 0.18
31 0.17
32 0.17
33 0.17
34 0.18
35 0.18
36 0.2
37 0.21
38 0.22
39 0.22
40 0.24
41 0.31
42 0.29
43 0.28
44 0.25
45 0.23
46 0.23
47 0.25
48 0.23
49 0.17
50 0.18
51 0.21
52 0.31
53 0.39
54 0.44
55 0.49
56 0.53
57 0.6
58 0.69
59 0.75
60 0.76
61 0.78
62 0.84
63 0.88
64 0.93
65 0.92
66 0.88
67 0.89
68 0.83
69 0.82
70 0.75
71 0.68
72 0.59
73 0.51
74 0.47
75 0.37
76 0.32
77 0.21
78 0.17
79 0.13
80 0.14
81 0.12
82 0.08
83 0.09
84 0.09
85 0.09
86 0.1
87 0.09
88 0.07
89 0.07
90 0.07
91 0.06
92 0.06
93 0.07
94 0.08
95 0.11
96 0.18
97 0.22
98 0.24
99 0.28
100 0.31