Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1G030

Protein Details
Accession A0A6G1G030    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
409-429LNTKPRRLDKARYYSPKWIVKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 11.999, nucl 8, cyto_nucl 7.833
Family & Domain DBs
Amino Acid Sequences MCSRIKRVLGTAPGEQPQPSEPNLASRPAPKLELPKPAQLKAIPELHPVPKPATEEGSGQNIPSAEQQELIKKPQPEETVVEETASDAASAPDAPMAASSTRSPVVGEKVVPEVPHQTVGSGHQKSDNTPTAEATPGVPEKAAPPKCVVFEEPEEDTPPVHGLDTTATKDKPNEVQEPMEPTAEQNLASLDTLPGVPRGEPPRRSSKTPPPPSSRKVTIAEQPQSAPASSHSSVVPFASVRRFAKNWTLPSLRHARAPATSPEQDAAPQQEQEQGVIRGEPSDVAAPNENVASRKDSAFTLGSKKGATDASAPKPSDTTPANVASSAYDDPNLGAPVIAERVAVLSDDLPERQEQQGLGASGQRNNPQGQLQPRDISATVDGSSTSAMPTPSPPGVVVVTGEHPSLLVLNTKPRRLDKARYYSPKWIVKASMGRKAADEVCFRIRAAQAGVRLETAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.4
3 0.34
4 0.32
5 0.31
6 0.27
7 0.27
8 0.24
9 0.3
10 0.33
11 0.34
12 0.33
13 0.34
14 0.38
15 0.36
16 0.39
17 0.35
18 0.42
19 0.45
20 0.52
21 0.51
22 0.55
23 0.57
24 0.56
25 0.56
26 0.49
27 0.48
28 0.44
29 0.47
30 0.4
31 0.4
32 0.43
33 0.43
34 0.44
35 0.41
36 0.38
37 0.34
38 0.36
39 0.33
40 0.32
41 0.29
42 0.29
43 0.3
44 0.33
45 0.3
46 0.26
47 0.26
48 0.22
49 0.21
50 0.21
51 0.2
52 0.14
53 0.16
54 0.18
55 0.23
56 0.27
57 0.31
58 0.33
59 0.34
60 0.35
61 0.4
62 0.41
63 0.38
64 0.39
65 0.4
66 0.4
67 0.37
68 0.35
69 0.28
70 0.25
71 0.22
72 0.18
73 0.11
74 0.06
75 0.06
76 0.06
77 0.06
78 0.06
79 0.06
80 0.06
81 0.05
82 0.05
83 0.07
84 0.07
85 0.09
86 0.09
87 0.12
88 0.12
89 0.13
90 0.13
91 0.14
92 0.18
93 0.19
94 0.19
95 0.17
96 0.2
97 0.21
98 0.21
99 0.2
100 0.19
101 0.18
102 0.21
103 0.19
104 0.16
105 0.16
106 0.21
107 0.28
108 0.25
109 0.25
110 0.26
111 0.27
112 0.29
113 0.35
114 0.36
115 0.3
116 0.29
117 0.3
118 0.27
119 0.27
120 0.26
121 0.19
122 0.16
123 0.14
124 0.14
125 0.12
126 0.11
127 0.13
128 0.23
129 0.25
130 0.22
131 0.25
132 0.26
133 0.28
134 0.3
135 0.28
136 0.22
137 0.23
138 0.25
139 0.24
140 0.23
141 0.23
142 0.21
143 0.2
144 0.16
145 0.14
146 0.11
147 0.09
148 0.08
149 0.06
150 0.08
151 0.11
152 0.13
153 0.15
154 0.16
155 0.17
156 0.18
157 0.21
158 0.24
159 0.27
160 0.28
161 0.27
162 0.29
163 0.29
164 0.34
165 0.32
166 0.27
167 0.22
168 0.18
169 0.18
170 0.16
171 0.15
172 0.09
173 0.08
174 0.08
175 0.08
176 0.08
177 0.05
178 0.05
179 0.06
180 0.06
181 0.06
182 0.06
183 0.07
184 0.11
185 0.18
186 0.24
187 0.27
188 0.32
189 0.41
190 0.44
191 0.49
192 0.52
193 0.56
194 0.61
195 0.67
196 0.71
197 0.68
198 0.72
199 0.71
200 0.7
201 0.63
202 0.57
203 0.5
204 0.45
205 0.43
206 0.43
207 0.42
208 0.36
209 0.32
210 0.29
211 0.26
212 0.23
213 0.18
214 0.12
215 0.15
216 0.14
217 0.15
218 0.14
219 0.14
220 0.14
221 0.13
222 0.13
223 0.07
224 0.08
225 0.09
226 0.13
227 0.14
228 0.17
229 0.18
230 0.19
231 0.28
232 0.32
233 0.33
234 0.34
235 0.36
236 0.33
237 0.37
238 0.44
239 0.36
240 0.33
241 0.31
242 0.27
243 0.25
244 0.28
245 0.27
246 0.24
247 0.24
248 0.22
249 0.22
250 0.2
251 0.19
252 0.18
253 0.18
254 0.14
255 0.13
256 0.13
257 0.16
258 0.16
259 0.16
260 0.17
261 0.14
262 0.13
263 0.13
264 0.12
265 0.09
266 0.09
267 0.08
268 0.07
269 0.08
270 0.08
271 0.09
272 0.1
273 0.1
274 0.11
275 0.11
276 0.11
277 0.1
278 0.11
279 0.13
280 0.13
281 0.13
282 0.14
283 0.14
284 0.16
285 0.17
286 0.18
287 0.2
288 0.21
289 0.21
290 0.2
291 0.2
292 0.19
293 0.18
294 0.17
295 0.18
296 0.22
297 0.27
298 0.33
299 0.33
300 0.32
301 0.32
302 0.31
303 0.3
304 0.25
305 0.22
306 0.2
307 0.22
308 0.22
309 0.21
310 0.21
311 0.16
312 0.18
313 0.16
314 0.13
315 0.1
316 0.1
317 0.1
318 0.12
319 0.11
320 0.08
321 0.07
322 0.07
323 0.07
324 0.08
325 0.08
326 0.06
327 0.05
328 0.06
329 0.06
330 0.06
331 0.06
332 0.05
333 0.07
334 0.08
335 0.09
336 0.1
337 0.1
338 0.13
339 0.13
340 0.15
341 0.13
342 0.14
343 0.17
344 0.17
345 0.17
346 0.19
347 0.2
348 0.22
349 0.26
350 0.28
351 0.27
352 0.28
353 0.29
354 0.28
355 0.32
356 0.37
357 0.4
358 0.4
359 0.39
360 0.38
361 0.39
362 0.36
363 0.32
364 0.25
365 0.2
366 0.17
367 0.15
368 0.14
369 0.11
370 0.12
371 0.1
372 0.09
373 0.08
374 0.09
375 0.09
376 0.11
377 0.15
378 0.15
379 0.16
380 0.16
381 0.16
382 0.16
383 0.16
384 0.15
385 0.12
386 0.14
387 0.14
388 0.14
389 0.12
390 0.11
391 0.11
392 0.11
393 0.09
394 0.11
395 0.12
396 0.23
397 0.29
398 0.33
399 0.38
400 0.42
401 0.5
402 0.53
403 0.62
404 0.62
405 0.67
406 0.74
407 0.78
408 0.8
409 0.8
410 0.82
411 0.8
412 0.72
413 0.65
414 0.58
415 0.56
416 0.6
417 0.57
418 0.57
419 0.52
420 0.5
421 0.47
422 0.49
423 0.46
424 0.42
425 0.39
426 0.34
427 0.37
428 0.38
429 0.36
430 0.36
431 0.33
432 0.3
433 0.31
434 0.3
435 0.3
436 0.33
437 0.34