Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1G2D1

Protein Details
Accession A0A6G1G2D1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
19-38LPPMHKFRLRRPNKMSENPCHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR017264  Ribosomal_MRP10_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Amino Acid Sequences MVPKPPVTGRPTALKAPRLPPMHKFRLRRPNKMSENPCITIMSSVLGCWASSGYTTSGCMAMEQQLRACMDAQKAPQKSKSTINYHLARMYRYMKGPHKRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.5
4 0.55
5 0.52
6 0.52
7 0.53
8 0.56
9 0.6
10 0.63
11 0.64
12 0.66
13 0.71
14 0.76
15 0.77
16 0.75
17 0.75
18 0.76
19 0.8
20 0.75
21 0.72
22 0.71
23 0.62
24 0.56
25 0.45
26 0.37
27 0.27
28 0.22
29 0.15
30 0.08
31 0.07
32 0.06
33 0.06
34 0.05
35 0.05
36 0.05
37 0.04
38 0.04
39 0.05
40 0.05
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.07
47 0.06
48 0.1
49 0.12
50 0.12
51 0.12
52 0.14
53 0.15
54 0.15
55 0.16
56 0.14
57 0.14
58 0.17
59 0.22
60 0.27
61 0.31
62 0.34
63 0.4
64 0.42
65 0.43
66 0.48
67 0.52
68 0.52
69 0.55
70 0.6
71 0.58
72 0.56
73 0.58
74 0.51
75 0.44
76 0.42
77 0.39
78 0.35
79 0.36
80 0.42
81 0.46