Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1G8T2

Protein Details
Accession A0A6G1G8T2    Localization Confidence Low Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
51-71LLVRLLRYRRRDKIHAKFPFPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13.5, cyto_mito 10.333, cyto 6, cyto_nucl 5.833, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046366  MPAB  
Gene Ontology GO:0016491  F:oxidoreductase activity  
Amino Acid Sequences MSSSLSTDFVRQLLEKIIARIELSKSQLLQLPWGTYLAPRNVAVASIAYLLLVRLLRYRRRDKIHAKFPFPTRDSLSRMTTLQAWEINKMLGEYEFPFMGQKALQFALFRTYGIPTISKLLVDTKQLSDVSLASKQRYADTEVLIGEFVINPPDSERTINAISRMNYLHSGYRKSGKISNDDLLYTLSLFALEPIKFVGMYEWRGNSELEKCAVGVFWKAIGDAQGISFEALRRFHMGWKDGLEWLEDVQEWATKYEQQHMVPSEYNKKTADETVRILVYDVPGPLKWIGNQFVSCLMDEKLRTAMMYPPPYAPLKFTVDTGLLVRKYFLRYLALPRIIPFKAFSQPDPKTGRSHKVLYMSEPWYIPATFANRWGITAWYKWTMGLPYPGDPKYEPDGYDLEEVGPKLFRGKGKKEMEETRRTLTEARRGGCPFAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.25
4 0.26
5 0.24
6 0.25
7 0.26
8 0.26
9 0.26
10 0.28
11 0.29
12 0.28
13 0.3
14 0.34
15 0.3
16 0.31
17 0.29
18 0.27
19 0.24
20 0.24
21 0.22
22 0.2
23 0.26
24 0.25
25 0.25
26 0.23
27 0.23
28 0.23
29 0.23
30 0.2
31 0.14
32 0.12
33 0.1
34 0.09
35 0.08
36 0.08
37 0.07
38 0.09
39 0.09
40 0.08
41 0.13
42 0.2
43 0.28
44 0.37
45 0.47
46 0.53
47 0.61
48 0.71
49 0.76
50 0.8
51 0.83
52 0.83
53 0.8
54 0.78
55 0.77
56 0.77
57 0.68
58 0.62
59 0.58
60 0.55
61 0.54
62 0.52
63 0.48
64 0.41
65 0.39
66 0.36
67 0.33
68 0.28
69 0.25
70 0.25
71 0.22
72 0.21
73 0.21
74 0.2
75 0.17
76 0.16
77 0.14
78 0.09
79 0.1
80 0.11
81 0.11
82 0.11
83 0.11
84 0.12
85 0.11
86 0.12
87 0.1
88 0.09
89 0.11
90 0.12
91 0.13
92 0.12
93 0.13
94 0.16
95 0.15
96 0.15
97 0.13
98 0.14
99 0.14
100 0.15
101 0.15
102 0.12
103 0.15
104 0.15
105 0.14
106 0.13
107 0.16
108 0.16
109 0.19
110 0.21
111 0.18
112 0.21
113 0.21
114 0.21
115 0.18
116 0.17
117 0.16
118 0.19
119 0.2
120 0.18
121 0.2
122 0.2
123 0.21
124 0.22
125 0.24
126 0.21
127 0.2
128 0.21
129 0.18
130 0.18
131 0.16
132 0.14
133 0.09
134 0.07
135 0.06
136 0.06
137 0.06
138 0.05
139 0.07
140 0.09
141 0.1
142 0.11
143 0.11
144 0.14
145 0.16
146 0.17
147 0.18
148 0.21
149 0.2
150 0.21
151 0.21
152 0.18
153 0.18
154 0.18
155 0.2
156 0.2
157 0.22
158 0.22
159 0.27
160 0.27
161 0.29
162 0.32
163 0.31
164 0.33
165 0.34
166 0.34
167 0.29
168 0.28
169 0.26
170 0.21
171 0.18
172 0.13
173 0.09
174 0.06
175 0.05
176 0.05
177 0.05
178 0.08
179 0.07
180 0.07
181 0.08
182 0.08
183 0.08
184 0.08
185 0.09
186 0.08
187 0.1
188 0.12
189 0.13
190 0.13
191 0.14
192 0.15
193 0.14
194 0.15
195 0.13
196 0.12
197 0.12
198 0.11
199 0.1
200 0.1
201 0.09
202 0.07
203 0.06
204 0.05
205 0.05
206 0.05
207 0.05
208 0.06
209 0.06
210 0.05
211 0.05
212 0.05
213 0.05
214 0.05
215 0.06
216 0.06
217 0.08
218 0.08
219 0.09
220 0.11
221 0.12
222 0.15
223 0.18
224 0.19
225 0.19
226 0.2
227 0.21
228 0.19
229 0.19
230 0.16
231 0.13
232 0.11
233 0.11
234 0.08
235 0.07
236 0.06
237 0.07
238 0.07
239 0.08
240 0.08
241 0.11
242 0.12
243 0.18
244 0.22
245 0.21
246 0.25
247 0.26
248 0.28
249 0.27
250 0.3
251 0.33
252 0.3
253 0.32
254 0.29
255 0.28
256 0.27
257 0.3
258 0.31
259 0.25
260 0.26
261 0.26
262 0.25
263 0.24
264 0.23
265 0.18
266 0.14
267 0.12
268 0.11
269 0.09
270 0.09
271 0.11
272 0.11
273 0.11
274 0.12
275 0.14
276 0.16
277 0.18
278 0.18
279 0.17
280 0.19
281 0.19
282 0.17
283 0.16
284 0.14
285 0.14
286 0.14
287 0.15
288 0.14
289 0.13
290 0.13
291 0.12
292 0.17
293 0.21
294 0.25
295 0.25
296 0.24
297 0.27
298 0.29
299 0.28
300 0.24
301 0.22
302 0.23
303 0.23
304 0.22
305 0.21
306 0.2
307 0.21
308 0.2
309 0.21
310 0.17
311 0.16
312 0.17
313 0.17
314 0.19
315 0.2
316 0.2
317 0.18
318 0.2
319 0.28
320 0.35
321 0.36
322 0.33
323 0.34
324 0.37
325 0.34
326 0.32
327 0.26
328 0.21
329 0.26
330 0.27
331 0.29
332 0.34
333 0.35
334 0.43
335 0.47
336 0.46
337 0.46
338 0.51
339 0.56
340 0.52
341 0.54
342 0.5
343 0.52
344 0.51
345 0.48
346 0.48
347 0.42
348 0.39
349 0.35
350 0.32
351 0.26
352 0.25
353 0.21
354 0.18
355 0.21
356 0.19
357 0.23
358 0.27
359 0.25
360 0.26
361 0.26
362 0.25
363 0.23
364 0.25
365 0.25
366 0.23
367 0.23
368 0.23
369 0.25
370 0.24
371 0.24
372 0.28
373 0.26
374 0.27
375 0.33
376 0.34
377 0.34
378 0.32
379 0.34
380 0.34
381 0.35
382 0.31
383 0.28
384 0.29
385 0.29
386 0.3
387 0.26
388 0.21
389 0.2
390 0.2
391 0.18
392 0.17
393 0.14
394 0.16
395 0.2
396 0.25
397 0.32
398 0.39
399 0.48
400 0.56
401 0.63
402 0.67
403 0.73
404 0.75
405 0.76
406 0.73
407 0.7
408 0.63
409 0.58
410 0.56
411 0.53
412 0.54
413 0.51
414 0.49
415 0.5
416 0.5