FuNGI

A0A6G1G8T2

Protein Details

Accession

A0A6G1G8T2

Localization Confidence

Low

Confidence Score

6.1

NoLS Segment(s)

Position	Sequence	Protein Nature
51-71	LLVRLLRYRRRDKIHAKFPFP	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 13.5, cyto_mito 10.333, cyto 6, cyto_nucl 5.833, nucl 4.5

Family & Domain DBs

InterPro	View protein in InterPro IPR046366 MPAB
Gene Ontology	GO:0016491 F:oxidoreductase activity

Amino Acid Sequences

MSSSLSTDFVRQLLEKIIARIELSKSQLLQLPWGTYLAPRNVAVASIAYLLLVRLLRYRRRDKIHAKFPFPTRDSLSRMTTLQAWEINKMLGEYEFPFMGQKALQFALFRTYGIPTISKLLVDTKQLSDVSLASKQRYADTEVLIGEFVINPPDSERTINAISRMNYLHSGYRKSGKISNDDLLYTLSLFALEPIKFVGMYEWRGNSELEKCAVGVFWKAIGDAQGISFEALRRFHMGWKDGLEWLEDVQEWATKYEQQHMVPSEYNKKTADETVRILVYDVPGPLKWIGNQFVSCLMDEKLRTAMMYPPPYAPLKFTVDTGLLVRKYFLRYLALPRIIPFKAFSQPDPKTGRSHKVLYMSEPWYIPATFANRWGITAWYKWTMGLPYPGDPKYEPDGYDLEEVGPKLFRGKGKKEMEETRRTLTEARRGGCPFAV

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.25
2	0.24
3	0.25
4	0.26
5	0.24
6	0.25
7	0.26
8	0.26
9	0.26
10	0.28
11	0.29
12	0.28
13	0.3
14	0.34
15	0.3
16	0.31
17	0.29
18	0.27
19	0.24
20	0.24
21	0.22
22	0.2
23	0.26
24	0.25
25	0.25
26	0.23
27	0.23
28	0.23
29	0.23
30	0.2
31	0.14
32	0.12
33	0.1
34	0.09
35	0.08
36	0.08
37	0.07
38	0.09
39	0.09
40	0.08
41	0.13
42	0.2
43	0.28
44	0.37
45	0.47
46	0.53
47	0.61
48	0.71
49	0.76
50	0.8
51	0.83
52	0.83
53	0.8
54	0.78
55	0.77
56	0.77
57	0.68
58	0.62
59	0.58
60	0.55
61	0.54
62	0.52
63	0.48
64	0.41
65	0.39
66	0.36
67	0.33
68	0.28
69	0.25
70	0.25
71	0.22
72	0.21
73	0.21
74	0.2
75	0.17
76	0.16
77	0.14
78	0.09
79	0.1
80	0.11
81	0.11
82	0.11
83	0.11
84	0.12
85	0.11
86	0.12
87	0.1
88	0.09
89	0.11
90	0.12
91	0.13
92	0.12
93	0.13
94	0.16
95	0.15
96	0.15
97	0.13
98	0.14
99	0.14
100	0.15
101	0.15
102	0.12
103	0.15
104	0.15
105	0.14
106	0.13
107	0.16
108	0.16
109	0.19
110	0.21
111	0.18
112	0.21
113	0.21
114	0.21
115	0.18
116	0.17
117	0.16
118	0.19
119	0.2
120	0.18
121	0.2
122	0.2
123	0.21
124	0.22
125	0.24
126	0.21
127	0.2
128	0.21
129	0.18
130	0.18
131	0.16
132	0.14
133	0.09
134	0.07
135	0.06
136	0.06
137	0.06
138	0.05
139	0.07
140	0.09
141	0.1
142	0.11
143	0.11
144	0.14
145	0.16
146	0.17
147	0.18
148	0.21
149	0.2
150	0.21
151	0.21
152	0.18
153	0.18
154	0.18
155	0.2
156	0.2
157	0.22
158	0.22
159	0.27
160	0.27
161	0.29
162	0.32
163	0.31
164	0.33
165	0.34
166	0.34
167	0.29
168	0.28
169	0.26
170	0.21
171	0.18
172	0.13
173	0.09
174	0.06
175	0.05
176	0.05
177	0.05
178	0.08
179	0.07
180	0.07
181	0.08
182	0.08
183	0.08
184	0.08
185	0.09
186	0.08
187	0.1
188	0.12
189	0.13
190	0.13
191	0.14
192	0.15
193	0.14
194	0.15
195	0.13
196	0.12
197	0.12
198	0.11
199	0.1
200	0.1
201	0.09
202	0.07
203	0.06
204	0.05
205	0.05
206	0.05
207	0.05
208	0.06
209	0.06
210	0.05
211	0.05
212	0.05
213	0.05
214	0.05
215	0.06
216	0.06
217	0.08
218	0.08
219	0.09
220	0.11
221	0.12
222	0.15
223	0.18
224	0.19
225	0.19
226	0.2
227	0.21
228	0.19
229	0.19
230	0.16
231	0.13
232	0.11
233	0.11
234	0.08
235	0.07
236	0.06
237	0.07
238	0.07
239	0.08
240	0.08
241	0.11
242	0.12
243	0.18
244	0.22
245	0.21
246	0.25
247	0.26
248	0.28
249	0.27
250	0.3
251	0.33
252	0.3
253	0.32
254	0.29
255	0.28
256	0.27
257	0.3
258	0.31
259	0.25
260	0.26
261	0.26
262	0.25
263	0.24
264	0.23
265	0.18
266	0.14
267	0.12
268	0.11
269	0.09
270	0.09
271	0.11
272	0.11
273	0.11
274	0.12
275	0.14
276	0.16
277	0.18
278	0.18
279	0.17
280	0.19
281	0.19
282	0.17
283	0.16
284	0.14
285	0.14
286	0.14
287	0.15
288	0.14
289	0.13
290	0.13
291	0.12
292	0.17
293	0.21
294	0.25
295	0.25
296	0.24
297	0.27
298	0.29
299	0.28
300	0.24
301	0.22
302	0.23
303	0.23
304	0.22
305	0.21
306	0.2
307	0.21
308	0.2
309	0.21
310	0.17
311	0.16
312	0.17
313	0.17
314	0.19
315	0.2
316	0.2
317	0.18
318	0.2
319	0.28
320	0.35
321	0.36
322	0.33
323	0.34
324	0.37
325	0.34
326	0.32
327	0.26
328	0.21
329	0.26
330	0.27
331	0.29
332	0.34
333	0.35
334	0.43
335	0.47
336	0.46
337	0.46
338	0.51
339	0.56
340	0.52
341	0.54
342	0.5
343	0.52
344	0.51
345	0.48
346	0.48
347	0.42
348	0.39
349	0.35
350	0.32
351	0.26
352	0.25
353	0.21
354	0.18
355	0.21
356	0.19
357	0.23
358	0.27
359	0.25
360	0.26
361	0.26
362	0.25
363	0.23
364	0.25
365	0.25
366	0.23
367	0.23
368	0.23
369	0.25
370	0.24
371	0.24
372	0.28
373	0.26
374	0.27
375	0.33
376	0.34
377	0.34
378	0.32
379	0.34
380	0.34
381	0.35
382	0.31
383	0.28
384	0.29
385	0.29
386	0.3
387	0.26
388	0.21
389	0.2
390	0.2
391	0.18
392	0.17
393	0.14
394	0.16
395	0.2
396	0.25
397	0.32
398	0.39
399	0.48
400	0.56
401	0.63
402	0.67
403	0.73
404	0.75
405	0.76
406	0.73
407	0.7
408	0.63
409	0.58
410	0.56
411	0.53
412	0.54
413	0.51
414	0.49
415	0.5
416	0.5

A0A6G1G8T2

3D AlphaFold-predicted Structure Viewer