Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1GB94

Protein Details
Accession A0A6G1GB94    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
76-98AEAQAKKQKKLRALKKQQLELEMHydrophilic
NLS Segment(s)
PositionSequence
82-87KQKKLR
Subcellular Location(s) cyto 19, mito 5.5, mito_nucl 4
Family & Domain DBs
Amino Acid Sequences MAGLLGGGGGGKKGGNGGLLGGVLDTVDNTTKDLPVVGGVTSPVLKTVGETTDGLPVVGSGGGKQQVQKSEGGSEAEAQAKKQKKLRALKKQQLELEMAEMEED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.07
5 0.07
6 0.07
7 0.07
8 0.06
9 0.05
10 0.04
11 0.04
12 0.03
13 0.04
14 0.05
15 0.06
16 0.07
17 0.08
18 0.08
19 0.08
20 0.08
21 0.07
22 0.07
23 0.07
24 0.06
25 0.05
26 0.05
27 0.06
28 0.06
29 0.06
30 0.05
31 0.05
32 0.05
33 0.05
34 0.07
35 0.07
36 0.08
37 0.09
38 0.09
39 0.11
40 0.11
41 0.1
42 0.09
43 0.08
44 0.06
45 0.06
46 0.05
47 0.03
48 0.05
49 0.07
50 0.08
51 0.1
52 0.12
53 0.15
54 0.17
55 0.18
56 0.18
57 0.18
58 0.19
59 0.18
60 0.16
61 0.14
62 0.14
63 0.18
64 0.17
65 0.16
66 0.23
67 0.28
68 0.33
69 0.38
70 0.42
71 0.47
72 0.57
73 0.67
74 0.71
75 0.76
76 0.8
77 0.83
78 0.86
79 0.81
80 0.73
81 0.65
82 0.55
83 0.46
84 0.37