Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1FY81

Protein Details
Accession A0A6G1FY81    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
30-49IPLYRRILRAHRRKLHPDMRBasic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008381  SDHAF3/Sdh7  
Gene Ontology GO:0005759  C:mitochondrial matrix  
GO:0006094  P:gluconeogenesis  
GO:0034553  P:mitochondrial respiratory chain complex II assembly  
Pfam View protein in Pfam  
PF13233  Complex1_LYR_2  
CDD cd20270  Complex1_LYR_SDHAF3_LYRM10  
Amino Acid Sequences MRPSLKTMATAASAAQLATARSSVALLPPIPLYRRILRAHRRKLHPDMRMLGDQYVKSEFRAHKTVENPVHIIGFLSEWQQYAQALEGESWREEKLDQGKMAKMSDEQLVQLYDLMQTIHNPSPDDNSSGTESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.09
5 0.09
6 0.09
7 0.07
8 0.07
9 0.08
10 0.08
11 0.08
12 0.1
13 0.1
14 0.11
15 0.12
16 0.15
17 0.15
18 0.17
19 0.21
20 0.22
21 0.28
22 0.32
23 0.4
24 0.48
25 0.58
26 0.66
27 0.7
28 0.74
29 0.75
30 0.8
31 0.79
32 0.74
33 0.69
34 0.62
35 0.57
36 0.51
37 0.44
38 0.36
39 0.3
40 0.25
41 0.2
42 0.19
43 0.15
44 0.14
45 0.19
46 0.19
47 0.21
48 0.25
49 0.25
50 0.26
51 0.28
52 0.35
53 0.32
54 0.32
55 0.29
56 0.25
57 0.24
58 0.19
59 0.17
60 0.1
61 0.07
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.07
68 0.07
69 0.06
70 0.07
71 0.06
72 0.06
73 0.07
74 0.07
75 0.08
76 0.09
77 0.1
78 0.09
79 0.09
80 0.09
81 0.14
82 0.19
83 0.22
84 0.24
85 0.26
86 0.29
87 0.3
88 0.31
89 0.27
90 0.22
91 0.19
92 0.19
93 0.17
94 0.15
95 0.14
96 0.14
97 0.13
98 0.13
99 0.11
100 0.09
101 0.08
102 0.08
103 0.07
104 0.08
105 0.13
106 0.16
107 0.18
108 0.19
109 0.2
110 0.25
111 0.27
112 0.29
113 0.25
114 0.25