Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4NVL8

Protein Details
Accession F4NVL8   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
109-128TRQVERKKTGQPGARKKNTWHydrophilic
NLS Segment(s)
PositionSequence
115-127KKTGQPGARKKNT
Subcellular Location(s) cyto 14, cyto_nucl 9.833, cyto_pero 8.833, mito 6, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020568  Ribosomal_S5_D2-typ_fold  
IPR014721  Ribosomal_S5_D2-typ_fold_subgr  
IPR000754  Ribosomal_S9  
IPR020574  Ribosomal_S9_CS  
Gene Ontology GO:0005763  C:mitochondrial small ribosomal subunit  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00380  Ribosomal_S9  
PROSITE View protein in PROSITE  
PS00360  RIBOSOMAL_S9  
Amino Acid Sequences LDADGRSYTIGSRKTARAQCWIVPGNGQVYVNGIRLPEYFRDMVNREVIVKPFEVANCLMKYNTWAIVSGGGHSGQAQAVAVAVARGIAIHDSTKENLFKKLGMLMIDTRQVERKKTGQPGARKKNTWVRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.47
3 0.47
4 0.49
5 0.5
6 0.5
7 0.52
8 0.5
9 0.41
10 0.36
11 0.34
12 0.28
13 0.25
14 0.22
15 0.14
16 0.15
17 0.16
18 0.15
19 0.14
20 0.12
21 0.11
22 0.12
23 0.14
24 0.13
25 0.15
26 0.15
27 0.15
28 0.19
29 0.2
30 0.22
31 0.22
32 0.21
33 0.19
34 0.2
35 0.21
36 0.17
37 0.15
38 0.13
39 0.12
40 0.12
41 0.12
42 0.11
43 0.14
44 0.13
45 0.13
46 0.13
47 0.11
48 0.13
49 0.12
50 0.13
51 0.09
52 0.09
53 0.09
54 0.11
55 0.11
56 0.1
57 0.09
58 0.07
59 0.07
60 0.07
61 0.07
62 0.05
63 0.05
64 0.04
65 0.03
66 0.03
67 0.03
68 0.03
69 0.02
70 0.02
71 0.02
72 0.02
73 0.02
74 0.03
75 0.03
76 0.04
77 0.05
78 0.07
79 0.09
80 0.1
81 0.14
82 0.18
83 0.19
84 0.22
85 0.22
86 0.21
87 0.21
88 0.22
89 0.21
90 0.17
91 0.18
92 0.17
93 0.19
94 0.23
95 0.22
96 0.21
97 0.27
98 0.28
99 0.3
100 0.33
101 0.37
102 0.41
103 0.49
104 0.56
105 0.57
106 0.66
107 0.73
108 0.79
109 0.81
110 0.76
111 0.76