Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1FUL8

Protein Details
Accession A0A6G1FUL8    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
34-60ILQGKPNRYRRSRPSNRTKRRFEARVQHydrophilic
NLS Segment(s)
PositionSequence
38-54KPNRYRRSRPSNRTKRR
Subcellular Location(s) nucl 17.5, cyto_nucl 14, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MKPILVRNKYQLDLRLGGGSYGEVVSRLVRIQRILQGKPNRYRRSRPSNRTKRRFEARVQPTQSFTSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.27
4 0.24
5 0.2
6 0.15
7 0.1
8 0.08
9 0.07
10 0.05
11 0.05
12 0.05
13 0.06
14 0.07
15 0.08
16 0.08
17 0.1
18 0.11
19 0.17
20 0.21
21 0.22
22 0.29
23 0.35
24 0.41
25 0.49
26 0.58
27 0.6
28 0.61
29 0.69
30 0.7
31 0.74
32 0.78
33 0.79
34 0.81
35 0.84
36 0.89
37 0.91
38 0.9
39 0.88
40 0.87
41 0.83
42 0.79
43 0.79
44 0.76
45 0.77
46 0.74
47 0.68
48 0.62