Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1GHX4

Protein Details
Accession A0A6G1GHX4    Localization Confidence High Confidence Score 23
NoLS Segment(s)
PositionSequenceProtein Nature
8-35LLPPQQHSQPSRKGKKAWRKNVDVSDVQHydrophilic
343-362QEVREKEKARQEKLRQKGEIBasic
418-448IVRGKIESRKRISQHKKPQRKATEKWTYKDWHydrophilic
NLS Segment(s)
PositionSequence
20-23KGKK
187-187K
300-356ASKLKSQAERNKINRRKEAERKAVHEKKMKQKDEQLRRVKAFAQEVREKEKARQEKL
420-439RGKIESRKRISQHKKPQRKA
Subcellular Location(s) nucl 15, mito 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR011687  Nop53/GLTSCR2  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005654  C:nucleoplasm  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF07767  Nop53  
Amino Acid Sequences IHPIMASLLPPQQHSQPSRKGKKAWRKNVDVSDVQSGLDEIREEIIQGGTALASRDLADLFALDTKGDTHARLQYQRDHRLKKPLKSEEILAQRSAVPAVGSKKRPAQTTDGVLRTTKKQRGEGISYKELERLRKIAYAGTQGPSHEIGKPDLHERASKNELSDLWAAPAKEPATDAEKFDFLPKKKPTRAPNTIKRAPLALSASGKPVRSVAKPDPGRSYNPLFDDWTNLFDREGAKEVEKERQRLASEEREQERLARVAASAAEAERKEAEEDAYFTESEWEGFNSEHEEGEAKTVKASKLKSQAERNKINRRKEAERKAVHEKKMKQKDEQLRRVKAFAQEVREKEKARQEKLRQKGEISDEDSADEETLRRKSFGKSQIPDQPLELVLADELQESLRLLKPEGNILKDRFRSMIVRGKIESRKRISQHKKPQRKATEKWTYKDWKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.46
3 0.53
4 0.62
5 0.7
6 0.75
7 0.78
8 0.8
9 0.85
10 0.88
11 0.89
12 0.88
13 0.87
14 0.88
15 0.87
16 0.84
17 0.76
18 0.69
19 0.64
20 0.54
21 0.45
22 0.35
23 0.27
24 0.2
25 0.17
26 0.13
27 0.08
28 0.09
29 0.09
30 0.09
31 0.1
32 0.1
33 0.09
34 0.08
35 0.08
36 0.06
37 0.07
38 0.08
39 0.07
40 0.07
41 0.07
42 0.08
43 0.08
44 0.08
45 0.07
46 0.07
47 0.07
48 0.09
49 0.09
50 0.08
51 0.08
52 0.09
53 0.13
54 0.14
55 0.14
56 0.15
57 0.22
58 0.27
59 0.33
60 0.36
61 0.42
62 0.5
63 0.6
64 0.65
65 0.66
66 0.66
67 0.72
68 0.76
69 0.74
70 0.76
71 0.74
72 0.72
73 0.67
74 0.65
75 0.62
76 0.63
77 0.57
78 0.47
79 0.39
80 0.32
81 0.3
82 0.27
83 0.19
84 0.1
85 0.12
86 0.18
87 0.24
88 0.27
89 0.3
90 0.38
91 0.41
92 0.45
93 0.45
94 0.45
95 0.44
96 0.48
97 0.51
98 0.46
99 0.43
100 0.42
101 0.4
102 0.4
103 0.44
104 0.42
105 0.39
106 0.42
107 0.47
108 0.52
109 0.58
110 0.58
111 0.57
112 0.57
113 0.54
114 0.5
115 0.48
116 0.44
117 0.4
118 0.35
119 0.3
120 0.27
121 0.28
122 0.28
123 0.25
124 0.25
125 0.27
126 0.26
127 0.25
128 0.24
129 0.21
130 0.23
131 0.22
132 0.2
133 0.17
134 0.16
135 0.17
136 0.18
137 0.19
138 0.2
139 0.21
140 0.22
141 0.24
142 0.24
143 0.28
144 0.31
145 0.3
146 0.27
147 0.26
148 0.25
149 0.24
150 0.25
151 0.19
152 0.16
153 0.17
154 0.16
155 0.14
156 0.17
157 0.13
158 0.11
159 0.12
160 0.12
161 0.14
162 0.15
163 0.16
164 0.15
165 0.15
166 0.15
167 0.2
168 0.26
169 0.23
170 0.31
171 0.37
172 0.44
173 0.5
174 0.57
175 0.61
176 0.64
177 0.73
178 0.74
179 0.77
180 0.78
181 0.76
182 0.7
183 0.62
184 0.53
185 0.43
186 0.36
187 0.28
188 0.21
189 0.18
190 0.17
191 0.21
192 0.21
193 0.2
194 0.17
195 0.18
196 0.18
197 0.17
198 0.22
199 0.22
200 0.3
201 0.32
202 0.34
203 0.38
204 0.37
205 0.39
206 0.37
207 0.37
208 0.3
209 0.29
210 0.28
211 0.24
212 0.22
213 0.23
214 0.19
215 0.18
216 0.17
217 0.15
218 0.14
219 0.13
220 0.14
221 0.11
222 0.13
223 0.11
224 0.11
225 0.14
226 0.15
227 0.22
228 0.25
229 0.26
230 0.25
231 0.28
232 0.28
233 0.28
234 0.32
235 0.32
236 0.34
237 0.39
238 0.39
239 0.38
240 0.37
241 0.36
242 0.33
243 0.25
244 0.2
245 0.13
246 0.11
247 0.1
248 0.09
249 0.08
250 0.07
251 0.06
252 0.09
253 0.08
254 0.09
255 0.09
256 0.09
257 0.09
258 0.09
259 0.1
260 0.08
261 0.09
262 0.11
263 0.12
264 0.11
265 0.1
266 0.12
267 0.1
268 0.1
269 0.1
270 0.08
271 0.08
272 0.08
273 0.08
274 0.1
275 0.1
276 0.09
277 0.09
278 0.1
279 0.09
280 0.13
281 0.15
282 0.12
283 0.13
284 0.16
285 0.18
286 0.21
287 0.24
288 0.27
289 0.34
290 0.41
291 0.46
292 0.54
293 0.61
294 0.66
295 0.73
296 0.75
297 0.77
298 0.78
299 0.8
300 0.77
301 0.75
302 0.76
303 0.77
304 0.78
305 0.77
306 0.75
307 0.73
308 0.76
309 0.77
310 0.75
311 0.73
312 0.71
313 0.72
314 0.77
315 0.75
316 0.7
317 0.72
318 0.75
319 0.77
320 0.79
321 0.78
322 0.75
323 0.73
324 0.69
325 0.63
326 0.58
327 0.55
328 0.49
329 0.47
330 0.46
331 0.48
332 0.52
333 0.54
334 0.5
335 0.47
336 0.53
337 0.54
338 0.54
339 0.61
340 0.64
341 0.69
342 0.77
343 0.8
344 0.73
345 0.66
346 0.66
347 0.62
348 0.57
349 0.52
350 0.45
351 0.36
352 0.34
353 0.33
354 0.27
355 0.2
356 0.15
357 0.11
358 0.13
359 0.18
360 0.18
361 0.19
362 0.21
363 0.25
364 0.34
365 0.43
366 0.48
367 0.48
368 0.54
369 0.62
370 0.63
371 0.6
372 0.52
373 0.44
374 0.34
375 0.31
376 0.23
377 0.14
378 0.11
379 0.1
380 0.09
381 0.07
382 0.07
383 0.06
384 0.06
385 0.06
386 0.09
387 0.12
388 0.13
389 0.15
390 0.19
391 0.2
392 0.29
393 0.33
394 0.35
395 0.38
396 0.41
397 0.49
398 0.47
399 0.49
400 0.41
401 0.39
402 0.38
403 0.38
404 0.43
405 0.39
406 0.41
407 0.41
408 0.48
409 0.54
410 0.59
411 0.63
412 0.6
413 0.65
414 0.67
415 0.76
416 0.78
417 0.8
418 0.83
419 0.84
420 0.88
421 0.89
422 0.94
423 0.94
424 0.92
425 0.9
426 0.89
427 0.89
428 0.86
429 0.81
430 0.8