Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6G1GE98

Protein Details
Accession A0A6G1GE98    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
90-112SSQTGLRKRNQRKIAKAIRRAIGHydrophilic
NLS Segment(s)
PositionSequence
97-108KRNQRKIAKAIR
Subcellular Location(s) nucl 9, mito 8, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR001648  Ribosomal_S18  
IPR036870  Ribosomal_S18_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01084  Ribosomal_S18  
Amino Acid Sequences QERAKEAQHARRLESQIARIWQPGDVYAPRDMGKSEQMKWSTTIKRMRNGTAGRERRDVFDTLGINPLNEYKNFSLLAEFTSSMGRIYNSSQTGLRKRNQRKIAKAIRRAIGIGLIPSVHHHPELVLRDPNWRP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.48
3 0.46
4 0.46
5 0.43
6 0.37
7 0.34
8 0.28
9 0.24
10 0.21
11 0.2
12 0.18
13 0.19
14 0.18
15 0.2
16 0.19
17 0.19
18 0.19
19 0.16
20 0.22
21 0.23
22 0.24
23 0.29
24 0.3
25 0.31
26 0.33
27 0.38
28 0.35
29 0.39
30 0.45
31 0.43
32 0.48
33 0.5
34 0.5
35 0.5
36 0.48
37 0.48
38 0.5
39 0.52
40 0.49
41 0.5
42 0.48
43 0.43
44 0.44
45 0.37
46 0.27
47 0.25
48 0.22
49 0.18
50 0.21
51 0.18
52 0.15
53 0.14
54 0.15
55 0.12
56 0.11
57 0.14
58 0.11
59 0.13
60 0.13
61 0.13
62 0.11
63 0.1
64 0.11
65 0.09
66 0.09
67 0.08
68 0.08
69 0.08
70 0.08
71 0.08
72 0.08
73 0.07
74 0.09
75 0.13
76 0.14
77 0.15
78 0.18
79 0.23
80 0.31
81 0.36
82 0.4
83 0.45
84 0.54
85 0.62
86 0.7
87 0.73
88 0.74
89 0.79
90 0.84
91 0.83
92 0.83
93 0.8
94 0.74
95 0.66
96 0.59
97 0.48
98 0.4
99 0.31
100 0.22
101 0.16
102 0.12
103 0.1
104 0.12
105 0.15
106 0.14
107 0.14
108 0.13
109 0.14
110 0.2
111 0.25
112 0.28
113 0.3
114 0.29