Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4P6A4

Protein Details
Accession F4P6A4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
42-71LKRRKGRTGKAANLKKKKSRGPSRIPGSARBasic
NLS Segment(s)
PositionSequence
40-78KFLKRRKGRTGKAANLKKKKSRGPSRIPGSARKITPRLR
Subcellular Location(s) mito 9, plas 8, extr 5, mito_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSSLLAGRTPKQFFSIGILLVSIAALTYLAITTRDYGPKFLKRRKGRTGKAANLKKKKSRGPSRIPGSARKITPRLRMFRF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.3
3 0.28
4 0.21
5 0.19
6 0.18
7 0.14
8 0.13
9 0.12
10 0.05
11 0.03
12 0.02
13 0.02
14 0.02
15 0.02
16 0.02
17 0.03
18 0.04
19 0.04
20 0.06
21 0.08
22 0.12
23 0.12
24 0.16
25 0.2
26 0.28
27 0.35
28 0.4
29 0.48
30 0.54
31 0.62
32 0.69
33 0.75
34 0.73
35 0.76
36 0.79
37 0.77
38 0.79
39 0.8
40 0.79
41 0.78
42 0.8
43 0.78
44 0.76
45 0.76
46 0.76
47 0.78
48 0.78
49 0.79
50 0.81
51 0.81
52 0.81
53 0.77
54 0.74
55 0.71
56 0.68
57 0.62
58 0.59
59 0.6
60 0.59
61 0.65
62 0.66