Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1FR73

Protein Details
Accession A0A6G1FR73    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-23RRHFVRKHPNKHHEGSRKRWRDQBasic
NLS Segment(s)
PositionSequence
7-21KHPNKHHEGSRKRWR
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR011992  EF-hand-dom_pair  
IPR000261  EH_dom  
Pfam View protein in Pfam  
PF12763  EF-hand_4  
PROSITE View protein in PROSITE  
PS50031  EH  
CDD cd00052  EH  
Amino Acid Sequences RRHFVRKHPNKHHEGSRKRWRDQVMERERKRYEGVWAANKGSQVLNSHGSGGGVQKNITGINGPENEVLNVAVREIWGRSRLPADVLAEVWELVDSRQIGCLTREEFVVGMWLVDQRLKGRKLPPSVSDSVWSSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.84
4 0.83
5 0.79
6 0.78
7 0.73
8 0.72
9 0.72
10 0.72
11 0.72
12 0.74
13 0.74
14 0.75
15 0.71
16 0.64
17 0.57
18 0.47
19 0.43
20 0.4
21 0.43
22 0.42
23 0.43
24 0.42
25 0.41
26 0.39
27 0.34
28 0.26
29 0.21
30 0.16
31 0.16
32 0.17
33 0.16
34 0.16
35 0.15
36 0.15
37 0.13
38 0.13
39 0.12
40 0.1
41 0.1
42 0.09
43 0.1
44 0.1
45 0.09
46 0.08
47 0.06
48 0.09
49 0.1
50 0.11
51 0.11
52 0.11
53 0.11
54 0.11
55 0.1
56 0.07
57 0.06
58 0.05
59 0.04
60 0.04
61 0.05
62 0.05
63 0.06
64 0.08
65 0.09
66 0.1
67 0.11
68 0.11
69 0.12
70 0.14
71 0.14
72 0.12
73 0.12
74 0.12
75 0.11
76 0.1
77 0.09
78 0.07
79 0.06
80 0.05
81 0.07
82 0.07
83 0.07
84 0.1
85 0.1
86 0.12
87 0.13
88 0.17
89 0.15
90 0.16
91 0.16
92 0.13
93 0.13
94 0.12
95 0.13
96 0.09
97 0.07
98 0.07
99 0.08
100 0.08
101 0.09
102 0.11
103 0.14
104 0.22
105 0.24
106 0.3
107 0.36
108 0.43
109 0.5
110 0.55
111 0.55
112 0.55
113 0.56
114 0.52
115 0.5