FuNGI

A0A6G1G266

Protein Details

Accession

A0A6G1G266

Localization Confidence

High

Confidence Score

16.6

NoLS Segment(s)

Position	Sequence	Protein Nature
8-34	QDKVQDQTRSPRPQPPKPSSILRRRDD	Hydrophilic
39-61	LFCPAQRYQPLKRKRARDGYGNI	Hydrophilic

NLS Segment(s)

Position	Sequence
50-55	KRKRAR
65-67	KKR

Subcellular Location(s)

nucl 17, cyto_nucl 12, cyto 5, pero 3

Family & Domain DBs

InterPro	View protein in InterPro IPR025533 DUF4419
Pfam	View protein in Pfam PF14388 DUF4419

Amino Acid Sequences

MPIRVDLQDKVQDQTRSPRPQPPKPSSILRRRDDPADDLFCPAQRYQPLKRKRARDGYGNIGSEKKRKADIIHRPEFQGIIRSTFGDLSPTPVVPHGVPFIRLIVGAFERGINLALRPDDVWLAIMAQVGRMLKGSLNLRGKYLTEWDADRYMMITFDKRSHHSSTDNHINAMLNEEADLSDYRLVDDSRYDSNFIDGMPLQGNSSVFNASVKDIEKELHKEVGLNIEDEEFKKWVALDFSTSTDADRIAGEVSLFGAAGPRNAFPLSATTSCPPSIQLLGTLKDWVEILRRVKQMPQMHYKFGEWNSLLEPIIFRIVHSLERPESEKYKNFWKAAYHPIVDRSTRTVRLVSGWITVFNYWDEEGKRVNHFSTPKLLAAPTLYKLPKVYDVPWADRSILADAMPKKVIGMPVVVAQDNPDGLQHFIVVSGCRVTPRKGVDDESVVGNTESGWWLLKVSLNPTDRKSEF

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.48
2	0.52
3	0.54
4	0.57
5	0.63
6	0.66
7	0.73
8	0.8
9	0.79
10	0.77
11	0.73
12	0.79
13	0.79
14	0.8
15	0.81
16	0.75
17	0.74
18	0.7
19	0.7
20	0.64
21	0.57
22	0.55
23	0.5
24	0.46
25	0.42
26	0.4
27	0.35
28	0.34
29	0.3
30	0.29
31	0.3
32	0.36
33	0.43
34	0.51
35	0.59
36	0.67
37	0.74
38	0.78
39	0.81
40	0.85
41	0.81
42	0.81
43	0.77
44	0.76
45	0.75
46	0.68
47	0.59
48	0.54
49	0.52
50	0.49
51	0.46
52	0.4
53	0.37
54	0.38
55	0.43
56	0.48
57	0.56
58	0.59
59	0.63
60	0.62
61	0.6
62	0.58
63	0.52
64	0.43
65	0.39
66	0.3
67	0.25
68	0.24
69	0.22
70	0.22
71	0.22
72	0.21
73	0.17
74	0.15
75	0.17
76	0.18
77	0.18
78	0.17
79	0.17
80	0.19
81	0.15
82	0.17
83	0.16
84	0.15
85	0.16
86	0.16
87	0.16
88	0.15
89	0.14
90	0.13
91	0.11
92	0.11
93	0.1
94	0.1
95	0.09
96	0.09
97	0.09
98	0.1
99	0.08
100	0.07
101	0.09
102	0.09
103	0.1
104	0.1
105	0.1
106	0.1
107	0.09
108	0.1
109	0.07
110	0.07
111	0.07
112	0.08
113	0.07
114	0.07
115	0.09
116	0.08
117	0.08
118	0.08
119	0.08
120	0.07
121	0.12
122	0.14
123	0.2
124	0.27
125	0.27
126	0.28
127	0.29
128	0.29
129	0.26
130	0.28
131	0.22
132	0.17
133	0.18
134	0.19
135	0.19
136	0.19
137	0.17
138	0.14
139	0.11
140	0.11
141	0.1
142	0.1
143	0.11
144	0.15
145	0.18
146	0.21
147	0.25
148	0.28
149	0.3
150	0.33
151	0.35
152	0.38
153	0.46
154	0.43
155	0.38
156	0.36
157	0.33
158	0.28
159	0.27
160	0.19
161	0.09
162	0.08
163	0.08
164	0.07
165	0.08
166	0.08
167	0.06
168	0.08
169	0.08
170	0.08
171	0.09
172	0.09
173	0.08
174	0.09
175	0.11
176	0.13
177	0.13
178	0.15
179	0.13
180	0.14
181	0.14
182	0.13
183	0.12
184	0.09
185	0.09
186	0.09
187	0.09
188	0.08
189	0.09
190	0.09
191	0.08
192	0.09
193	0.08
194	0.07
195	0.07
196	0.08
197	0.07
198	0.09
199	0.09
200	0.09
201	0.09
202	0.1
203	0.12
204	0.15
205	0.16
206	0.16
207	0.15
208	0.15
209	0.15
210	0.2
211	0.18
212	0.15
213	0.13
214	0.12
215	0.13
216	0.13
217	0.14
218	0.08
219	0.08
220	0.08
221	0.07
222	0.08
223	0.08
224	0.08
225	0.09
226	0.1
227	0.11
228	0.13
229	0.13
230	0.12
231	0.11
232	0.11
233	0.09
234	0.07
235	0.06
236	0.05
237	0.05
238	0.05
239	0.04
240	0.04
241	0.04
242	0.04
243	0.03
244	0.05
245	0.05
246	0.06
247	0.07
248	0.07
249	0.08
250	0.08
251	0.08
252	0.07
253	0.09
254	0.12
255	0.13
256	0.15
257	0.14
258	0.16
259	0.17
260	0.17
261	0.15
262	0.12
263	0.12
264	0.11
265	0.14
266	0.14
267	0.15
268	0.15
269	0.15
270	0.14
271	0.13
272	0.13
273	0.09
274	0.1
275	0.14
276	0.17
277	0.23
278	0.26
279	0.26
280	0.3
281	0.37
282	0.4
283	0.42
284	0.49
285	0.45
286	0.46
287	0.47
288	0.45
289	0.42
290	0.36
291	0.36
292	0.26
293	0.24
294	0.22
295	0.22
296	0.21
297	0.16
298	0.15
299	0.1
300	0.12
301	0.11
302	0.1
303	0.11
304	0.12
305	0.14
306	0.15
307	0.18
308	0.16
309	0.18
310	0.21
311	0.22
312	0.25
313	0.29
314	0.33
315	0.32
316	0.41
317	0.46
318	0.45
319	0.43
320	0.44
321	0.44
322	0.48
323	0.51
324	0.43
325	0.37
326	0.41
327	0.42
328	0.38
329	0.35
330	0.31
331	0.3
332	0.32
333	0.32
334	0.28
335	0.25
336	0.26
337	0.28
338	0.22
339	0.21
340	0.19
341	0.18
342	0.18
343	0.17
344	0.15
345	0.13
346	0.13
347	0.1
348	0.14
349	0.14
350	0.15
351	0.18
352	0.21
353	0.24
354	0.25
355	0.25
356	0.28
357	0.3
358	0.3
359	0.34
360	0.34
361	0.32
362	0.31
363	0.3
364	0.25
365	0.26
366	0.26
367	0.2
368	0.24
369	0.24
370	0.23
371	0.25
372	0.26
373	0.28
374	0.29
375	0.29
376	0.3
377	0.35
378	0.39
379	0.42
380	0.41
381	0.36
382	0.33
383	0.33
384	0.26
385	0.22
386	0.17
387	0.2
388	0.2
389	0.22
390	0.22
391	0.2
392	0.19
393	0.2
394	0.22
395	0.17
396	0.16
397	0.14
398	0.17
399	0.2
400	0.19
401	0.16
402	0.16
403	0.16
404	0.15
405	0.14
406	0.11
407	0.11
408	0.11
409	0.12
410	0.1
411	0.09
412	0.1
413	0.11
414	0.11
415	0.1
416	0.12
417	0.12
418	0.17
419	0.2
420	0.23
421	0.28
422	0.33
423	0.38
424	0.4
425	0.44
426	0.43
427	0.44
428	0.43
429	0.39
430	0.34
431	0.29
432	0.25
433	0.2
434	0.16
435	0.13
436	0.12
437	0.1
438	0.1
439	0.09
440	0.1
441	0.12
442	0.16
443	0.17
444	0.22
445	0.29
446	0.33
447	0.38
448	0.4

A0A6G1G266

3D AlphaFold-predicted Structure Viewer