Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6G1FXF1

Protein Details
Accession A0A6G1FXF1    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-76AELERLRRRRLERRATRLAEBasic
NLS Segment(s)
PositionSequence
64-66RRR
Subcellular Location(s) cysk 22, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018625  Pet100  
Gene Ontology GO:0016020  C:membrane  
GO:0005739  C:mitochondrion  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF09803  Pet100  
Amino Acid Sequences MGGPNLEVFKFGFYIMFPIGIMYYFGTNLDSKFSVDGFWPSKEQSNKIPTEPEDIRAELERLRRRRLERRATRLAEETRSQQDMAGDGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.09
5 0.09
6 0.09
7 0.08
8 0.09
9 0.06
10 0.06
11 0.06
12 0.06
13 0.08
14 0.08
15 0.08
16 0.1
17 0.1
18 0.1
19 0.1
20 0.1
21 0.09
22 0.09
23 0.14
24 0.13
25 0.14
26 0.15
27 0.15
28 0.2
29 0.22
30 0.23
31 0.25
32 0.29
33 0.29
34 0.29
35 0.31
36 0.27
37 0.32
38 0.3
39 0.27
40 0.23
41 0.22
42 0.22
43 0.21
44 0.21
45 0.17
46 0.24
47 0.3
48 0.32
49 0.38
50 0.43
51 0.5
52 0.59
53 0.66
54 0.7
55 0.72
56 0.77
57 0.81
58 0.78
59 0.74
60 0.71
61 0.65
62 0.6
63 0.52
64 0.49
65 0.44
66 0.43
67 0.38
68 0.32
69 0.29