Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6G1FWM2

Protein Details
Accession A0A6G1FWM2    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-48LRAVPKKKTTHSKKRMRQLAGHydrophilic
NLS Segment(s)
PositionSequence
32-45PKKKTTHSKKRMRQ
Subcellular Location(s) mito 14, extr 7, cyto 3, nucl 1, plas 1, E.R. 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences LPAIALPSLIPALSGASAILREIWDSVLRAVPKKKTTHSKKRMRQLAGKALKDVKFLVKCPACGRPKKAHFLCPYCVQGKDSRGPTVQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.05
3 0.05
4 0.06
5 0.06
6 0.06
7 0.05
8 0.05
9 0.06
10 0.07
11 0.08
12 0.09
13 0.09
14 0.12
15 0.14
16 0.18
17 0.22
18 0.27
19 0.31
20 0.34
21 0.4
22 0.48
23 0.57
24 0.64
25 0.7
26 0.75
27 0.77
28 0.83
29 0.85
30 0.79
31 0.76
32 0.71
33 0.71
34 0.67
35 0.6
36 0.53
37 0.5
38 0.45
39 0.39
40 0.34
41 0.3
42 0.24
43 0.25
44 0.31
45 0.28
46 0.29
47 0.31
48 0.39
49 0.4
50 0.45
51 0.51
52 0.53
53 0.57
54 0.66
55 0.67
56 0.67
57 0.68
58 0.66
59 0.65
60 0.61
61 0.6
62 0.52
63 0.5
64 0.44
65 0.41
66 0.41
67 0.44
68 0.42
69 0.41