Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1G513

Protein Details
Accession A0A6G1G513    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-31AKATTKAKVTKPEKRKKDPNAPKRGLSHydrophilic
NLS Segment(s)
PositionSequence
6-28KATTKAKVTKPEKRKKDPNAPKR
Subcellular Location(s) nucl 13.5, cyto_nucl 9.5, mito 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKAAKATTKAKVTKPEKRKKDPNAPKRGLSAYMFFANDNRDKVREDNPGIKFGDVGKALGEKWKELTDKDKAPYEAKAKVDKKRYEDEKAAYNAGGGDGSDDDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.74
3 0.77
4 0.79
5 0.83
6 0.88
7 0.88
8 0.9
9 0.91
10 0.91
11 0.91
12 0.85
13 0.77
14 0.71
15 0.63
16 0.55
17 0.46
18 0.38
19 0.29
20 0.27
21 0.25
22 0.2
23 0.19
24 0.19
25 0.2
26 0.2
27 0.18
28 0.17
29 0.19
30 0.21
31 0.25
32 0.28
33 0.29
34 0.34
35 0.34
36 0.36
37 0.35
38 0.32
39 0.27
40 0.21
41 0.21
42 0.14
43 0.12
44 0.09
45 0.09
46 0.1
47 0.13
48 0.13
49 0.1
50 0.11
51 0.14
52 0.15
53 0.16
54 0.21
55 0.24
56 0.28
57 0.31
58 0.34
59 0.33
60 0.34
61 0.38
62 0.37
63 0.36
64 0.36
65 0.43
66 0.44
67 0.5
68 0.58
69 0.58
70 0.6
71 0.64
72 0.67
73 0.65
74 0.65
75 0.61
76 0.59
77 0.56
78 0.52
79 0.41
80 0.35
81 0.28
82 0.21
83 0.18
84 0.1
85 0.08