Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6G1GGH8

Protein Details
Accession A0A6G1GGH8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
121-150LYASARPYPEKKKRRRSSGKKAGKAKTNMEHydrophilic
NLS Segment(s)
PositionSequence
129-146PEKKKRRRSSGKKAGKAK
Subcellular Location(s) nucl 16.5, cyto_nucl 13.333, cyto 7, cyto_mito 5.499
Family & Domain DBs
Amino Acid Sequences MHFFDSPSPNSSSTTITIGFSTSPSSIRSSSSTSSTSSTSSTSSSSDSTFTCAFPSWPASSTLSSSCPYTGSPTPSYLENPPSSFISDEDLFGDLEPMLLTEAPAPPRQYHQQVAQPLLPLYASARPYPEKKKRRRSSGKKAGKAKTNMETILEAKESL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.22
3 0.2
4 0.19
5 0.17
6 0.16
7 0.13
8 0.14
9 0.12
10 0.12
11 0.13
12 0.16
13 0.16
14 0.18
15 0.2
16 0.22
17 0.23
18 0.25
19 0.25
20 0.24
21 0.25
22 0.24
23 0.22
24 0.19
25 0.18
26 0.15
27 0.15
28 0.14
29 0.14
30 0.14
31 0.14
32 0.14
33 0.14
34 0.13
35 0.16
36 0.15
37 0.14
38 0.14
39 0.13
40 0.13
41 0.13
42 0.16
43 0.13
44 0.14
45 0.16
46 0.16
47 0.17
48 0.18
49 0.18
50 0.16
51 0.16
52 0.15
53 0.13
54 0.12
55 0.11
56 0.14
57 0.15
58 0.17
59 0.18
60 0.19
61 0.2
62 0.2
63 0.22
64 0.19
65 0.21
66 0.17
67 0.17
68 0.17
69 0.17
70 0.16
71 0.15
72 0.13
73 0.13
74 0.12
75 0.12
76 0.11
77 0.11
78 0.1
79 0.1
80 0.1
81 0.05
82 0.05
83 0.05
84 0.04
85 0.04
86 0.04
87 0.04
88 0.05
89 0.07
90 0.09
91 0.12
92 0.13
93 0.14
94 0.18
95 0.24
96 0.27
97 0.29
98 0.32
99 0.36
100 0.38
101 0.41
102 0.38
103 0.34
104 0.3
105 0.26
106 0.21
107 0.15
108 0.13
109 0.14
110 0.14
111 0.14
112 0.17
113 0.21
114 0.28
115 0.39
116 0.47
117 0.54
118 0.63
119 0.73
120 0.8
121 0.87
122 0.92
123 0.93
124 0.93
125 0.94
126 0.94
127 0.92
128 0.92
129 0.89
130 0.86
131 0.82
132 0.77
133 0.73
134 0.67
135 0.59
136 0.51
137 0.46
138 0.38
139 0.35