Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F4P502

Protein Details
Accession F4P502    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
119-152SGESFRSRYKKMKRLKQECKSAKRQEKDLRKEFEHydrophilic
NLS Segment(s)
PositionSequence
128-149KKMKRLKQECKSAKRQEKDLRK
158-172GWRGKLKRLKKMLTK
Subcellular Location(s) nucl 9, E.R. 5, golg 5, mito 2, cyto 2, extr 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MKFIDIILVLSVSAVASALVATPNAETRSHQLSKRSPGKGWEKLVEDNPNDDDASEPGPSNDGNSVESRLADAKRQREDICDKYRKYKDDLNQDALEYGFVDDVLSNQSSTEQYGDVDSGESFRSRYKKMKRLKQECKSAKRQEKDLRKEFEEQSGTGWRGKLKRLKKMLTKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.03
4 0.03
5 0.04
6 0.04
7 0.04
8 0.05
9 0.06
10 0.09
11 0.11
12 0.12
13 0.13
14 0.17
15 0.25
16 0.3
17 0.32
18 0.37
19 0.42
20 0.52
21 0.59
22 0.58
23 0.52
24 0.56
25 0.62
26 0.62
27 0.6
28 0.55
29 0.5
30 0.5
31 0.52
32 0.51
33 0.43
34 0.37
35 0.34
36 0.3
37 0.26
38 0.22
39 0.18
40 0.12
41 0.13
42 0.11
43 0.1
44 0.08
45 0.09
46 0.09
47 0.09
48 0.1
49 0.09
50 0.1
51 0.1
52 0.12
53 0.12
54 0.12
55 0.11
56 0.13
57 0.13
58 0.16
59 0.2
60 0.24
61 0.27
62 0.3
63 0.3
64 0.32
65 0.38
66 0.4
67 0.45
68 0.47
69 0.45
70 0.51
71 0.55
72 0.52
73 0.5
74 0.49
75 0.46
76 0.49
77 0.53
78 0.48
79 0.44
80 0.42
81 0.38
82 0.31
83 0.25
84 0.14
85 0.1
86 0.05
87 0.04
88 0.04
89 0.03
90 0.04
91 0.06
92 0.06
93 0.05
94 0.06
95 0.07
96 0.07
97 0.08
98 0.08
99 0.07
100 0.07
101 0.08
102 0.08
103 0.07
104 0.07
105 0.06
106 0.07
107 0.07
108 0.07
109 0.07
110 0.12
111 0.16
112 0.2
113 0.3
114 0.39
115 0.47
116 0.57
117 0.67
118 0.73
119 0.8
120 0.87
121 0.87
122 0.88
123 0.9
124 0.89
125 0.89
126 0.89
127 0.87
128 0.82
129 0.83
130 0.82
131 0.83
132 0.84
133 0.82
134 0.78
135 0.72
136 0.73
137 0.65
138 0.63
139 0.55
140 0.45
141 0.4
142 0.39
143 0.37
144 0.33
145 0.33
146 0.31
147 0.31
148 0.4
149 0.45
150 0.48
151 0.56
152 0.64
153 0.71