Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F4NUX4

Protein Details
Accession F4NUX4    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-31MSKSKNHTNHNQNKKAHRNGIRKPKANKHTSHydrophilic
NLS Segment(s)
PositionSequence
14-31KKAHRNGIRKPKANKHTS
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0002181  P:cytoplasmic translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MSKSKNHTNHNQNKKAHRNGIRKPKANKHTSLRGVDAKFRRNQRYAKMGSFTACTAAKSSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.82
4 0.81
5 0.8
6 0.8
7 0.84
8 0.83
9 0.81
10 0.8
11 0.81
12 0.8
13 0.76
14 0.73
15 0.68
16 0.68
17 0.65
18 0.59
19 0.53
20 0.5
21 0.45
22 0.46
23 0.44
24 0.41
25 0.42
26 0.47
27 0.51
28 0.51
29 0.55
30 0.55
31 0.59
32 0.58
33 0.57
34 0.53
35 0.48
36 0.44
37 0.4
38 0.34
39 0.29
40 0.24
41 0.2