Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1GEK9

Protein Details
Accession A0A6G1GEK9    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-37QKVNIPKTRRTYCKGRDCKKHTQHKVTQYKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MDVEEDQKVNIPKTRRTYCKGRDCKKHTQHKVTQYKAGKASQFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTACKTKAQLSLKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.57
3 0.6
4 0.67
5 0.72
6 0.78
7 0.81
8 0.81
9 0.82
10 0.83
11 0.87
12 0.87
13 0.88
14 0.87
15 0.86
16 0.85
17 0.85
18 0.87
19 0.8
20 0.78
21 0.72
22 0.67
23 0.61
24 0.56
25 0.47
26 0.39
27 0.37
28 0.36
29 0.37
30 0.34
31 0.38
32 0.4
33 0.44
34 0.48
35 0.56
36 0.52
37 0.57
38 0.64
39 0.61
40 0.63
41 0.61
42 0.59
43 0.55
44 0.57
45 0.48
46 0.43
47 0.4
48 0.33
49 0.35
50 0.37
51 0.36
52 0.31
53 0.38
54 0.42
55 0.51
56 0.59
57 0.62
58 0.62
59 0.65
60 0.72
61 0.73
62 0.71
63 0.68
64 0.63
65 0.6
66 0.59
67 0.53
68 0.49
69 0.46
70 0.4
71 0.34
72 0.32
73 0.31
74 0.35
75 0.42
76 0.45
77 0.48
78 0.57
79 0.65
80 0.7
81 0.67
82 0.62
83 0.59
84 0.54
85 0.53
86 0.53
87 0.53
88 0.54
89 0.58
90 0.54
91 0.5
92 0.49
93 0.42