Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

I7L8K7

Protein Details
Accession I7L8K7    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
69-88AHCCRECRLLQKNHDRCPVVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005345  PHF5  
Gene Ontology GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF03660  PHF5  
Amino Acid Sequences MHLHTKPRCGKISTDKAAMVCDRCSGKCYICTLDAGTSPTRVYICTSCFHSTYKDRCIVCGLKDPRNTAHCCRECRLLQKNHDRCPVVIQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.53
3 0.48
4 0.48
5 0.44
6 0.35
7 0.25
8 0.24
9 0.23
10 0.22
11 0.24
12 0.23
13 0.22
14 0.23
15 0.26
16 0.24
17 0.22
18 0.23
19 0.21
20 0.2
21 0.19
22 0.18
23 0.15
24 0.13
25 0.12
26 0.12
27 0.11
28 0.1
29 0.11
30 0.1
31 0.12
32 0.13
33 0.17
34 0.18
35 0.19
36 0.19
37 0.22
38 0.27
39 0.3
40 0.33
41 0.36
42 0.34
43 0.34
44 0.38
45 0.36
46 0.31
47 0.36
48 0.36
49 0.37
50 0.41
51 0.43
52 0.44
53 0.47
54 0.51
55 0.47
56 0.53
57 0.52
58 0.54
59 0.54
60 0.57
61 0.55
62 0.59
63 0.62
64 0.61
65 0.65
66 0.71
67 0.77
68 0.77
69 0.81
70 0.75