Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1GH63

Protein Details
Accession A0A6G1GH63    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
52-78QLSTTEAHSRKRRKKPRSARPKTICSIHydrophilic
NLS Segment(s)
PositionSequence
60-73SRKRRKKPRSARPK
Subcellular Location(s) plas 8, mito 6, pero 4, E.R. 4, mito_nucl 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTKGVRLIILRSEKESAPLNLLGFPFVVLGAPLIYIYMPVHSCDPAGCESSQLSTTEAHSRKRRKKPRSARPKTICSIVELKAKKTNPRNLKIGNRTLIMLRSHCPPRQNDARRVPDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.36
3 0.29
4 0.25
5 0.25
6 0.23
7 0.22
8 0.22
9 0.19
10 0.15
11 0.14
12 0.1
13 0.08
14 0.07
15 0.04
16 0.04
17 0.04
18 0.04
19 0.03
20 0.04
21 0.03
22 0.04
23 0.04
24 0.06
25 0.06
26 0.07
27 0.09
28 0.09
29 0.09
30 0.08
31 0.1
32 0.1
33 0.12
34 0.11
35 0.1
36 0.1
37 0.11
38 0.12
39 0.11
40 0.1
41 0.09
42 0.11
43 0.18
44 0.2
45 0.25
46 0.32
47 0.42
48 0.51
49 0.61
50 0.7
51 0.72
52 0.81
53 0.85
54 0.89
55 0.9
56 0.9
57 0.9
58 0.88
59 0.85
60 0.77
61 0.71
62 0.61
63 0.53
64 0.47
65 0.39
66 0.39
67 0.34
68 0.34
69 0.35
70 0.38
71 0.43
72 0.48
73 0.54
74 0.56
75 0.61
76 0.65
77 0.66
78 0.73
79 0.73
80 0.72
81 0.65
82 0.56
83 0.52
84 0.46
85 0.42
86 0.36
87 0.3
88 0.24
89 0.28
90 0.34
91 0.36
92 0.4
93 0.4
94 0.46
95 0.55
96 0.62
97 0.64
98 0.68