Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6G1FSB9

Protein Details
Accession A0A6G1FSB9    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
141-207ASSGRCTPSRTRKTPKPTRTRKPTRTGKPGTTPKPTKTPKLSRAVKPTKTPTRRPERPEPTRPAKLGHydrophilic
NLS Segment(s)
PositionSequence
150-209RTRKTPKPTRTRKPTRTGKPGTTPKPTKTPKLSRAVKPTKTPTRRPERPEPTRPAKLGKK
Subcellular Location(s) mito 10, nucl 7.5, cyto_nucl 6, cyto 3.5, plas 3, extr 3
Family & Domain DBs
Amino Acid Sequences MLRPLFLTLLLSSLLTSTSSSPTPAPLQRRHSDYTSHSEPSISGSYASAISAAQPSEPPSLPTEDTPDLPTVTGGSEIPTDLGDSETPTVTGQSEPLNSPNDSEVPSIPSNSTSSATDDLVTPSVTSDPELPISAPPSSAASSGRCTPSRTRKTPKPTRTRKPTRTGKPGTTPKPTKTPKLSRAVKPTKTPTRRPERPEPTRPAKLGKKCVPPDMKDGWRMRIGMCFGGGWNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.08
4 0.09
5 0.11
6 0.12
7 0.14
8 0.14
9 0.17
10 0.23
11 0.28
12 0.35
13 0.4
14 0.48
15 0.52
16 0.58
17 0.59
18 0.55
19 0.54
20 0.51
21 0.52
22 0.49
23 0.45
24 0.39
25 0.34
26 0.32
27 0.31
28 0.28
29 0.2
30 0.15
31 0.13
32 0.14
33 0.14
34 0.14
35 0.09
36 0.06
37 0.07
38 0.08
39 0.08
40 0.07
41 0.08
42 0.11
43 0.14
44 0.15
45 0.15
46 0.16
47 0.19
48 0.2
49 0.2
50 0.23
51 0.21
52 0.22
53 0.22
54 0.21
55 0.18
56 0.17
57 0.16
58 0.11
59 0.09
60 0.09
61 0.07
62 0.07
63 0.07
64 0.06
65 0.07
66 0.06
67 0.06
68 0.05
69 0.06
70 0.06
71 0.06
72 0.07
73 0.07
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.08
81 0.09
82 0.09
83 0.12
84 0.14
85 0.14
86 0.14
87 0.14
88 0.14
89 0.14
90 0.14
91 0.12
92 0.13
93 0.14
94 0.14
95 0.13
96 0.13
97 0.12
98 0.13
99 0.13
100 0.1
101 0.11
102 0.12
103 0.12
104 0.11
105 0.11
106 0.1
107 0.09
108 0.09
109 0.07
110 0.06
111 0.06
112 0.06
113 0.06
114 0.06
115 0.07
116 0.07
117 0.08
118 0.08
119 0.08
120 0.1
121 0.09
122 0.08
123 0.08
124 0.09
125 0.09
126 0.1
127 0.11
128 0.1
129 0.13
130 0.16
131 0.19
132 0.19
133 0.22
134 0.29
135 0.39
136 0.47
137 0.53
138 0.59
139 0.64
140 0.74
141 0.81
142 0.84
143 0.84
144 0.85
145 0.87
146 0.9
147 0.92
148 0.9
149 0.9
150 0.9
151 0.88
152 0.88
153 0.84
154 0.79
155 0.78
156 0.79
157 0.75
158 0.75
159 0.71
160 0.65
161 0.68
162 0.67
163 0.66
164 0.66
165 0.69
166 0.68
167 0.73
168 0.77
169 0.74
170 0.81
171 0.82
172 0.77
173 0.75
174 0.77
175 0.77
176 0.77
177 0.79
178 0.78
179 0.79
180 0.82
181 0.82
182 0.83
183 0.83
184 0.84
185 0.85
186 0.84
187 0.82
188 0.82
189 0.76
190 0.75
191 0.73
192 0.73
193 0.74
194 0.73
195 0.74
196 0.7
197 0.77
198 0.76
199 0.7
200 0.68
201 0.67
202 0.64
203 0.62
204 0.62
205 0.57
206 0.54
207 0.51
208 0.45
209 0.42
210 0.39
211 0.31
212 0.28
213 0.23