Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1G3G5

Protein Details
Accession A0A6G1G3G5    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
96-126GMATKRERASRQQRKQRKNRSKEFRGTAKTKHydrophilic
NLS Segment(s)
PositionSequence
100-134KRERASRQQRKQRKNRSKEFRGTAKTKGATKKKDK
Subcellular Location(s) mito 18, nucl 5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADSQVTLRTRKFIRNPLLGRRQMVVDVLHPNRANVSKDELRDKLSELYKAGKDQISVFGFKTQFGGGKSTGFALIYDSNDSMKKFEPQYRLVRFGMATKRERASRQQRKQRKNRSKEFRGTAKTKGATKKKDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.63
3 0.68
4 0.71
5 0.77
6 0.72
7 0.66
8 0.58
9 0.5
10 0.41
11 0.37
12 0.27
13 0.21
14 0.25
15 0.24
16 0.28
17 0.27
18 0.26
19 0.28
20 0.3
21 0.29
22 0.22
23 0.29
24 0.27
25 0.3
26 0.36
27 0.34
28 0.34
29 0.32
30 0.32
31 0.3
32 0.28
33 0.26
34 0.22
35 0.25
36 0.24
37 0.24
38 0.24
39 0.19
40 0.18
41 0.17
42 0.22
43 0.19
44 0.18
45 0.18
46 0.2
47 0.19
48 0.18
49 0.18
50 0.13
51 0.13
52 0.13
53 0.15
54 0.11
55 0.11
56 0.11
57 0.1
58 0.1
59 0.08
60 0.07
61 0.07
62 0.08
63 0.08
64 0.09
65 0.09
66 0.1
67 0.11
68 0.12
69 0.11
70 0.11
71 0.15
72 0.18
73 0.23
74 0.27
75 0.33
76 0.42
77 0.44
78 0.48
79 0.44
80 0.42
81 0.37
82 0.38
83 0.39
84 0.36
85 0.35
86 0.35
87 0.38
88 0.41
89 0.44
90 0.48
91 0.52
92 0.57
93 0.65
94 0.71
95 0.78
96 0.85
97 0.93
98 0.94
99 0.94
100 0.93
101 0.93
102 0.93
103 0.93
104 0.92
105 0.89
106 0.88
107 0.86
108 0.79
109 0.74
110 0.72
111 0.67
112 0.65
113 0.67
114 0.66