Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q8SWM4

Protein Details
Accession Q8SWM4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-23WRAFRLPKKKSEGKNTVKTLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, cyto_mito 12.666, mito_nucl 12.166, cyto_nucl 4.166, cyto 4
Family & Domain DBs
Amino Acid Sequences MATWRAFRLPKKKSEGKNTVKTLFTCVINFRVVSNAVAHVIDMLCNLEAEEVCVGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.8
3 0.79
4 0.81
5 0.78
6 0.73
7 0.66
8 0.58
9 0.52
10 0.44
11 0.35
12 0.27
13 0.22
14 0.21
15 0.19
16 0.18
17 0.14
18 0.13
19 0.12
20 0.12
21 0.11
22 0.09
23 0.09
24 0.09
25 0.09
26 0.08
27 0.07
28 0.06
29 0.06
30 0.06
31 0.06
32 0.06
33 0.06
34 0.07
35 0.07
36 0.08