Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6G1G904

Protein Details
Accession A0A6G1G904    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
81-111KLCDGCKSVRRKKKYVYIICSKNPKHKQRQGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 11, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000473  Ribosomal_L36  
IPR035977  Ribosomal_L36_sp  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00444  Ribosomal_L36  
Amino Acid Sequences MLARTLLLTSRQVSRPTCSSPFTQLPLRRSITSISQTLRFPRPNRPSQFLSPSGAVEANGTSIFTTVGQRRGMKVRTSVKKLCDGCKSVRRKKKYVYIICSKNPKHKQRQG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.38
3 0.41
4 0.43
5 0.39
6 0.38
7 0.4
8 0.41
9 0.4
10 0.43
11 0.43
12 0.43
13 0.47
14 0.47
15 0.41
16 0.39
17 0.37
18 0.34
19 0.32
20 0.32
21 0.28
22 0.27
23 0.28
24 0.31
25 0.36
26 0.36
27 0.35
28 0.42
29 0.48
30 0.54
31 0.57
32 0.58
33 0.57
34 0.55
35 0.58
36 0.5
37 0.44
38 0.36
39 0.31
40 0.26
41 0.2
42 0.16
43 0.1
44 0.08
45 0.06
46 0.05
47 0.05
48 0.04
49 0.04
50 0.04
51 0.05
52 0.08
53 0.1
54 0.14
55 0.17
56 0.18
57 0.2
58 0.26
59 0.29
60 0.28
61 0.34
62 0.4
63 0.46
64 0.52
65 0.55
66 0.52
67 0.57
68 0.58
69 0.57
70 0.54
71 0.5
72 0.51
73 0.55
74 0.62
75 0.64
76 0.7
77 0.72
78 0.73
79 0.78
80 0.8
81 0.82
82 0.81
83 0.8
84 0.8
85 0.81
86 0.81
87 0.82
88 0.78
89 0.78
90 0.78
91 0.8