Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3LY71

Protein Details
Accession A0A6J3LY71    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
74-101STMVGRVTCRRHPRRHRCQLYQHLQIETHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 9, nucl 7, mito 5, cyto 3.5, cyto_pero 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPRGWQAINTDDRHGGVVHSSHNYSVVMSIVTGAPNQRSCKFGQDELGTTGRDQDQCLAPWWAIWVTVTVVAVSTMVGRVTCRRHPRRHRCQLYQHLQIET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.21
3 0.16
4 0.15
5 0.15
6 0.16
7 0.17
8 0.16
9 0.17
10 0.16
11 0.14
12 0.13
13 0.1
14 0.07
15 0.06
16 0.07
17 0.06
18 0.06
19 0.07
20 0.07
21 0.09
22 0.13
23 0.17
24 0.17
25 0.19
26 0.2
27 0.26
28 0.28
29 0.26
30 0.27
31 0.26
32 0.26
33 0.27
34 0.27
35 0.21
36 0.18
37 0.18
38 0.15
39 0.13
40 0.12
41 0.11
42 0.11
43 0.12
44 0.14
45 0.14
46 0.12
47 0.11
48 0.12
49 0.1
50 0.08
51 0.08
52 0.07
53 0.06
54 0.07
55 0.07
56 0.06
57 0.06
58 0.06
59 0.06
60 0.05
61 0.04
62 0.04
63 0.04
64 0.05
65 0.06
66 0.11
67 0.17
68 0.25
69 0.36
70 0.45
71 0.56
72 0.68
73 0.78
74 0.84
75 0.9
76 0.92
77 0.91
78 0.92
79 0.92
80 0.9
81 0.89