Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A6J3MHM1

Protein Details
Accession A0A6J3MHM1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
79-99NASYASRKDHRPNGWRPREIRHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 26
Family & Domain DBs
Amino Acid Sequences MVLQLQVGPAHHLWSWNNLLFSGVVVNSCLLSLELTDAFTGATADDVVEHHGRQRGLSAHVSCVWYSPHRFSGALHRSNASYASRKDHRPNGWRPREIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.25
4 0.25
5 0.23
6 0.23
7 0.2
8 0.19
9 0.14
10 0.09
11 0.07
12 0.07
13 0.07
14 0.06
15 0.06
16 0.06
17 0.05
18 0.05
19 0.05
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.05
26 0.05
27 0.05
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.06
35 0.07
36 0.07
37 0.09
38 0.12
39 0.12
40 0.12
41 0.14
42 0.13
43 0.16
44 0.21
45 0.2
46 0.18
47 0.21
48 0.22
49 0.19
50 0.19
51 0.18
52 0.17
53 0.19
54 0.2
55 0.21
56 0.22
57 0.22
58 0.22
59 0.31
60 0.36
61 0.38
62 0.36
63 0.35
64 0.33
65 0.34
66 0.36
67 0.29
68 0.27
69 0.25
70 0.32
71 0.36
72 0.43
73 0.51
74 0.57
75 0.63
76 0.65
77 0.74
78 0.77
79 0.81