Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A6J3MAV2

Protein Details
Accession A0A6J3MAV2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
16-35VYYHSCSKPNAKKKRYLTKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MCGKAHCVAFLSTVFVYYHSCSKPNAKKKRYLTKALLFIMTGTSWYRRCALPYTNVDNKAPFHPIPYALI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.15
4 0.14
5 0.2
6 0.17
7 0.19
8 0.2
9 0.3
10 0.39
11 0.47
12 0.56
13 0.56
14 0.64
15 0.72
16 0.8
17 0.77
18 0.76
19 0.72
20 0.68
21 0.68
22 0.59
23 0.5
24 0.39
25 0.32
26 0.25
27 0.17
28 0.12
29 0.08
30 0.1
31 0.1
32 0.12
33 0.14
34 0.14
35 0.16
36 0.2
37 0.23
38 0.28
39 0.34
40 0.41
41 0.46
42 0.49
43 0.48
44 0.45
45 0.44
46 0.39
47 0.38
48 0.3
49 0.26
50 0.26